Genuine Diamond Lotus Flower Earrings for Women

Regular price $1,103.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Symbolic Design with Refined Elegance

These diamond lotus flower earrings are designed for those who appreciate jewelry with both meaning and visual appeal. Inspired by the lotus motif, the design reflects balance and renewal while maintaining a clean and graceful form.

Their subtle presence makes them suitable for daily wear as well as occasions where understated elegance is preferred.

Floral Structure with Thoughtful Detailing

The lotus-inspired setting is carefully structured to create depth without excessive complexity. Each element contributes to the overall shape, forming a cohesive design that draws attention without appearing overly intricate.

This approach allows the earrings to remain visually interesting while preserving a refined and wearable look.

Natural Diamonds with Balanced Brilliance

The use of genuine diamonds introduces a controlled sparkle that enhances the floral design. Rather than overpowering the structure, the stones are arranged to complement the shape and provide a subtle play of light.

This creates a harmonious balance between brilliance and design clarity.

Designed for Comfortable Everyday Use

The earrings are crafted to sit comfortably on the ear, making them suitable for extended wear. Their balanced weight and secure design ensure ease of use throughout the day.

This makes them a practical option for those looking for jewelry that can transition seamlessly between occasions.

A Timeless Floral Addition

Floral motifs have long been valued for their versatility, and the lotus design adds a unique dimension to this tradition. These earrings offer a timeless aesthetic that remains relevant across changing styles.

They are well suited for those who want a piece that feels both meaningful and enduring.

Product Information
SKU SHP-EARRINGS032155412
Length 7 mm
Width 5.6 mm
Weight 1.40 gm (Approximate)
Total Stone Weight 0.37 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 20 Pieces
Total Weight 0.37 Carat (Approximate)
Dimension(approx) Marquise-1.50X3.00 mm-6 Pcs
Round-0.80X0.80 mm-12 Pcs
Round-1.30X1.30 mm-2 Pcs
Color HI
Cut Brilliant
Shape Marquise, Round
Setting Type V-Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
diamond-earrings

Faq About: Genuine Diamond Lotus Flower Earrings for Women

What does the lotus flower design symbolize in jewelry?
The lotus flower is often associated with renewal, balance, and beauty, making it a meaningful choice for jewelry design.
Are these earrings suitable for everyday wear?
Yes, the earrings are designed to be comfortable and practical for regular use while maintaining an elegant appearance.
Do the diamonds appear subtle or prominent?
The diamonds are arranged to provide balanced brilliance, enhancing the design without appearing overly bold.
Can these earrings be paired with other jewelry?
Their refined design allows them to pair easily with other pieces, including rings and necklaces with similar tones or styles.
Are floral earrings considered timeless?
Floral designs have remained popular over time due to their versatility, making them a lasting choice in jewelry collections.
Do these earrings work for formal occasions?
Yes, their elegant and structured design makes them suitable for both formal events and everyday wear.