Genuine Diamond Heart Earring for Cartilage Piercing

Regular price $938.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Delicate Heart Motif for Cartilage

The Adorable Diamond Gold Heart Earring for Cartilage Piercing is designed to bring a subtle romantic detail to elevated ear placements. Its heart silhouette is compact and refined, making it suitable for curated ear combinations.

This piece is intended for those who appreciate symbolic design in a minimal format. The heart shape offers softness, while the diamond accent introduces light and definition.

Cartilage-Specific Design Structure

Crafted for cartilage wear, the structure is scaled for upper-ear piercings where balance and fit are essential. The compact profile allows the earring to sit neatly against the ear without overwhelming surrounding pieces.

The gold framework supports the heart outline while securing the diamond detail within the design.

Diamond Suitability for Daily Styling

Diamonds are valued for their durability and natural brilliance, making them appropriate for fine jewelry worn regularly. When properly secured, they maintain their appearance even with frequent use.

High-Level Features

This cartilage earring combines a gold heart motif with diamond detailing in a single-piece format. The design focuses on symbolic elegance, secure placement, and compatibility with layered ear styling.

Product Information
SKU SHP-BODYJ052210151
Weight 0.54 gm (Approximate)
DIAMOND INFORMATION
No.of Stones 4 Pieces
Total Weight 0.08 Carat (Approximate)
Dimension(approx) Marquise-1.50X3.00 mm-1 Pcs
Round-1.30X1.30 mm-3 Pcs
Color HI
Cut Brilliant
Shape Marquise, Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
tragus-earrings

FAQs About: Diamond Gold Heart Earring for Cartilage Piercing

Is this heart earring designed specifically for cartilage?
Yes, the scale and structure are suited for cartilage placements such as helix or similar upper-ear piercings.
Is the earring sold individually or as a pair?
Cartilage earrings are commonly offered as single pieces for curated styling. Please check the product details table for exact inclusions.
Is a diamond heart earring suitable for everyday wear?
Diamonds are known for their strength and resistance to wear, making them appropriate for daily use when properly set.
Will the heart motif sit flat against the ear?
The compact design is intended to rest close to the cartilage, helping maintain a neat and balanced appearance.
How should I care for a gold and diamond cartilage earring?
Gentle cleaning with mild soap and water and occasional inspection of the setting can help maintain shine and security.