Freshwater Pearl Flower Pendant with Created Ruby and Moissanite

Sale price $770.00 Regular price $865.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Indulge in the serenity of white pearl with this enchanting Freshwater Pearl Cocktail Pendant Necklace. The flower pendant features a 10 MM Freshwater Pearl elegantly surrounded by a halo of created rubies and moissanite accents arranged in a designer motif. The designer pendant is crafted from Solid Gold, adding to its allure and beauty, making it an exquisite accessory that will make you look captivating and unforgettable.

Product Information
SKU SHP-PENDANT042210099
Metal Weight 3.70 gm (Approximate)
Total Stone Weight 10.43 Carat (Approximate)
FRESHWATER PEARL INFORMATION
No.of Stones 1 Pieces
Total Weight 8.00 Carat (Approximate)
Dimension(approx) Round-10X10 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade AAA
LAB CREATED RUBY INFORMATION
No.of Stones 50 Pieces
Total Weight 2.43 Carat (Approximate)
Dimension(approx) Marquise-2.50X5.00 mm-5 Pcs
Round-1.50X1.50 mm-45 Pcs
Color Red
Cut Brilliant
Shape Marquise, Round
Setting Type Bead-Set
Quality Grade AAAA
View More

Product Parent Collection Handle
freshwater-pearl-necklaces