Flower Pendant Necklace with Lab Grown Diamond

Sale price $628.00 Regular price $722.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Flourish in elegance with our Flower Pendant Necklace featuring a 4 mm Round Shape Diamond (Lab Grown) at the center set in a safe prong setting. The delicately crafted floral motif is aptivating and accentuated by dainty gemstones. Elevate your style with this mesmerizing Ef-Vs Quality Diamond Pendant Necklace (Synthetic) brought to you by Rosec Jewels, committed to merging stunning aesthetics with ethical practices. Also, this Diamond Floral Necklace can be your lady loves in-budget birthstone pendant as a diamond is an April Birthstone. Our jewelry comes in a premium box that can later be used to store the jewelry when not in use.

Product Information
SKU SHP-PENDANT122310147
Metal Weight 3.50 gm (Approximate)
Total Stone Weight 0.46 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 27 Pieces
Total Weight 0.46 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-26 Pcs
Round-4X4 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More