Ethiopian Opal Solitaire Infinity Necklace with Moissanite

Sale price $1,863.00 Regular price $2,093.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K White Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

If you want a necklace that feels special every time you wear it, this Ethiopian Opal Pendant is made for you. At the heart of this design lies a stunning 8 MM cushion shaped Ethiopian Opal, which sits securely in prong setting and is embraced by an infinity shaped design. The infinity motif is decorated with sparkling round cut Moissanite stones that add just the right amount of shimmer, giving the Solitaire Pendant Necklace a touch of magic without being overpowering. This Infinity Necklace is more than just jewelry, it carries meaning. The infinity shape represents love, friendship, and connection that lasts forever. It is a reminder of unending possibilities, loyalty, and the special bonds we share. Whether you are celebrating a birthday, anniversary, or another meaningful moment, this Opal and Moissanite Necklace makes a thoughtful and memorable gift. The chain is delicate yet sturdy, designed to sit gracefully around the neck and compliment any outfit, from casual wear to special occasions. Give it as a gift or treat yourself - it is a symbol of beauty, connection, and endless love that you will treasure for years.

Product Information
SKU SHP-PENDANT062193731
Length 21 mm
Width 8.8 mm
Metal Weight 3.78 gm (Approximate)
Total Stone Weight 2.03 Carat (Approximate)
ETHIOPIAN OPAL INFORMATION
No.of Stones 1 Pieces
Total Weight 1.87 Carat (Approximate)
Dimension(approx) Cushion-8X8 mm-1 Pcs
Color Rainbow
Cut Brilliant
Shape Cushion
Setting Type Prong-Setting
Quality Grade AAA
MOISSANITE INFORMATION
No.of Stones 8 Pieces
Total Weight 0.16 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-1 Pcs
Round-1.30X1.30 mm-1 Pcs
Round-1.40X1.40 mm-6 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
opal-necklaces