Diamond Lotus Flower Earring for Conch Piercing

Sale price $798.00 Regular price $917.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

The Diamond Lotus Flower Earring for Conch Piercing brings a soft floral accent to curated ear styling. A single round diamond sits within a lotus-inspired motif, adding a refined point of sparkle without overwhelming the ear. Designed as a single piercing earring, it works beautifully for conch, helix, cartilage, tragus, or upper lobe placements, making it a thoughtful gift for a birthday, anniversary, Mother’s Day, or a personal style milestone.

Lotus Flower Earring for Conch Piercing with Diamond Center Stone

This floral piercing earring is accented with 1 round diamond weighing approximately 0.05 carat. The diamond measures approximately 2X2 mm and is brilliant cut to bring light to the center of the lotus design. A prong setting secures the stone while keeping the look delicate, dimensional, and easy to pair with other ear jewelry.

What Makes This Special

The lotus motif gives this conch earring a nature-inspired identity, while the round diamond adds a clean sparkle at the heart of the design.

The diamond is HI color and SI quality grade, set in a prong setting for a refined finish. With an approximate total diamond weight of 0.05 carat and an approximate metal weight of 0.90 gm, the piece is made to feel detailed yet compact for piercing wear.

This single earring is available in 10K, 14K, and 18K yellow or white gold, with flat back post length options from 4.5 mm to 7.5 mm and left or right ear selection.

Why Choose This Design

A lotus flower earring brings more character than a simple stud while still keeping the styling polished and wearable. The floral outline softens the look of diamond body jewelry, making it suitable for everyday outfits as well as dressier moments.

The round brilliant diamond creates a focused sparkle, while the flat back post options help support comfortable wear in cartilage-style placements. The choice of yellow or white gold lets the piece align naturally with an existing jewelry stack.

Design Meaning

The lotus is often associated with renewal, growth, and inner strength, making this design especially meaningful as a gift or self-purchase. Its flower-inspired form adds a personal touch to piercing jewelry, symbolizing beauty that feels calm, expressive, and intentionally chosen.

Authenticity & Craftsmanship

This diamond lotus earring is crafted with attention to the floral form, secure stone placement, and refined finishing. Rosec Jewels offers a Certificate of Authenticity with the product for added purchase confidence. Each piece goes through stone inspection, setting security review, and finishing inspection before dispatch. To care for it, keep the earring away from harsh chemicals, perfumes, and chlorine, store it separately, and wipe it gently with a soft cloth after wear.

Style and Wearability

This single lotus earring can be styled as the focal point of a conch piercing or layered with hoops, studs, and small cartilage earrings for a curated ear look. Yellow gold brings warmth to the floral design, while white gold gives the diamond a crisp, bright appearance. Its compact flower shape makes it versatile enough for casual, formal, and party styling.

Product Information
SKU SHP-BODYJ022410056
Weight 0.90 gm (Approximate)
Center Stone Weight 0.05 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 1 Pieces
Total Weight 0.05 Carat (Approximate)
Dimension(approx) Round-2X2 mm-1 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

FAQs About: Diamond Lotus Flower Earring for Conch Piercing

What stone is used in the Diamond Lotus Flower Earring for Conch Piercing?

This earring features 1 round diamond with an approximate total weight of 0.05 carat. The diamond measures approximately 2X2 mm.

What is the diamond quality of this lotus flower earring?

The diamond is brilliant cut with HI color and SI quality grade. The gemstone quality option also includes Lab - EF-VS and Natural - HI-SI selections.

Is this earring suitable for conch piercing only?

No. This floral diamond earring can be worn on conch, helix, cartilage, tragus, or upper lobe piercings, depending on the wearer’s piercing placement and fit preference.

Is the Diamond Lotus Flower Earring sold as a single piece or a pair?

This earring is sold singly, making it ideal for one-ear styling, asymmetric piercing looks, or mixing with other studs and cartilage earrings.

What metal options are available for this diamond lotus earring?

This earring is available in 10K yellow gold, 10K white gold, 14K yellow gold, 14K white gold, 18K yellow gold, and 18K white gold.

What does the lotus flower design symbolize?

The lotus-inspired design gives the earring a meaningful floral character often connected with renewal, growth, and strength, making it a thoughtful choice for gifting or personal wear.

How should I care for this diamond lotus conch earring?

Keep the earring away from harsh chemicals, perfumes, chlorine, and abrasive cleaners. Store it separately and clean it gently with a soft cloth after wear to help maintain the diamond sparkle and metal finish.