Diamond Flower Engagement Ring with Split Shank

Regular price $1,962.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This Real Diamond Engagement Ring features a beautiful floral design, making it an ideal piece to celebrate your special day. It is a delicate and elegant piece that feels like a dream come true, inspired by the beauty of nature to create a feminine look. The ring showcases a 4 MM Round Shaped Diamond set in Claw Setting. With a Round Diamond Halo and additional Marquise Cut Stones, it resembles a delicate leaf, enhanced by a Split Shank. Crafted with great attention to detail, this Diamond Flower Engagement Ring highlights a floral motif. The intricate design paired with a timeless style makes the Diamond Halo Ring a fantastic choice, capturing the magical feelings tied to each bloom while honoring natural beauty. The HI Color SI Clarity diamond provides a unique variety of styles to elevate your appearance. Beautifully packaged in a signature jewelry box, this Split Shank Engagement Ring is ready to be gifted and cherished. Let your love shine with a sparkle that is gentle on the environment and perfect for your happily ever after. This Flower Ring exudes luxury and elegance, making it an absolutely stunning choice.

Product Information
SKU SHP-RINGS022150143
Width 3.8 mm
Height 7 mm
Metal Weight 2.52 gm (Approximate)
Total Stone Weight 0.57 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 17 Pieces
Total Weight 0.57 Carat (Approximate)
Dimension(approx) Marquise-1.50X3.00 mm-4 Pcs
Round-1.30X1.30 mm-12 Pcs
Round-4X4 mm-1 Pcs
Color HI
Cut Brilliant
Shape Marquise, Round
Setting Type Claw-Set
Quality Grade SI
View More

Product Parent Collection Handle
diamond-engagement-rings