Diamond Floral Earring for Tragus Piercing

Sale price $781.00 Regular price $898.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Ear stacking is all the rage! This Diamond Floral Earring is adorned with a Round Diamond set in Prong Setting on a half floral motif, crafted with Solid Metal.This Diamond Earring is perfect for your Helix, Cartilage, or Upper Lobe Piercing. The simple Flat Back Closure will keep it secured in place.Whether you style this Gold Flower Earring with your everyday attire or dressy ones, youll definitely stand out. Explore our stud collection to discover cute and trendy earrings and curate the perfect pair for creating the helix ear stack of your dreams!

Product Information
SKU SHP-BODYJ022410055
Metal Weight 0.90 gm (Approximate)
Total Stone Weight 0.05 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 1 Pieces
Total Weight 0.05 Carat (Approximate)
Dimension(approx) Round-2X2 mm-1 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More