Diamond Butterfly Hoop Earrings

Regular price $777.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Playful Motif in a Classic Hoop

The diamond butterfly hoop earrings combine a timeless hoop silhouette with a delicate butterfly accent. Designed for those who appreciate subtle symbolism, the butterfly detail introduces softness and movement to a structured form. This balance makes the earrings suitable for everyday styling as well as more considered occasions.

Butterfly Detail & Hoop Structure

The hoop form provides a familiar and versatile foundation, while the butterfly element adds a refined focal point. Diamond accents are arranged to enhance light reflection without overwhelming the overall outline. The structure is designed to sit comfortably on the ear, offering a composed profile that complements both minimal and layered looks.

Natural Diamond Brilliance

Crafted with natural diamonds, these earrings deliver enduring sparkle suited for regular wear. Diamonds are valued for their durability and long-term appeal, making them appropriate for jewelry intended to be worn frequently. As with all fine pieces, routine care helps maintain their appearance over time.

High-Level Features

  • Classic hoop silhouette with butterfly-inspired detail.
  • Natural diamond accents for refined brilliance.
  • Balanced design suited for daily wear.
  • Available in multiple precious metal options.
Product Information
SKU SHP-EARRINGS042166314
Metal Weight 4.00 gm (Approximate)
Total Stone Weight 0.42 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 88 Pieces
Total Weight 0.42 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-8 Pcs
Round-1X1 mm-8 Pcs
Round-0.90X0.90 mm-16 Pcs
Round-0.80X0.80 mm-56 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Surface-Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
diamond-earrings

FAQs About: Diamond Butterfly Hoop Earrings

Are the diamonds in these earrings natural?
The product details specify natural diamonds. Please review the product specification tables for full diamond information.
Are these hoop earrings suitable for everyday wear?
Yes. The hoop structure and diamond setting are designed for regular wear when properly maintained.
What does the butterfly motif represent?
The butterfly is often associated with transformation and renewal, making these earrings meaningful as a personal accessory or gift.
What metal options are available?
Available metal selections are shown in the product options and detailed in the product specification tables on the page.
How should I care for these earrings?
Clean gently with mild soap and lukewarm water using a soft brush. Store separately to help maintain the finish and reduce surface contact.
Are these earrings suitable for gifting?
The butterfly detail and diamond accents make them appropriate for birthdays, celebrations, or meaningful occasions.