Created Blue Sapphire and Moissanite Cluster Statement Stud Earrings

Sale price $612.00 Regular price $704.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

These enchanting Flower Cluster Earrings embody timeless charm and modern craftsmanship, brought to life through the brilliance of lab-grown gemstones. Featuring a harmonious arrangement of lab grown blue sapphire and sparkling lab grown diamonds, these Statement Studs are an elegant and ethical choice for refined everyday wear or special occasions. At the center of each earring lies a vivid round cut blue sapphire surrounded by a cluster of meticulously arranged diamonds, forming a symmetrical flower motif. The design mimics the natural beauty of a blooming flower, while every stone is held by secure prong setting to capture maximum light. The Sapphire and Diamond Stud Earrings are finished with secure screw back posts, offering enhanced stability and comfort for all-day wear. These Sapphire Flower Earrings offer a refined fusion of classic inspiration and contemporary sensibility. Whether worn as a bridal accessory, a symbolic gift, or a personal statement of elegance, they beautifully combine the luxury of fine jewelry with the conscious choice of lab-grown stones - capturing beauty, brilliance, and intention in every detail.

Product Information
SKU SHP-EARRINGS082210126
Metal Weight 2.10 gm (Approximate)
Total Stone Weight 0.88 Carat (Approximate)
LAB CREATED BLUE SAPPHIRE INFORMATION
No.of Stones 2 Pieces
Total Weight 0.08 Carat (Approximate)
Dimension(approx) Round-2X2 mm-2 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAAA
LAB GROWN DIAMOND INFORMATION
No.of Stones 36 Pieces
Total Weight 0.80 Carat (Approximate)
Dimension(approx) Round-1.60X1.60 mm-24 Pcs
Round-1.80X1.80 mm-12 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More

Product Parent Collection Handle
stud-earrings