Certified Real Emerald Flower Engagement Ring with Diamond Bypass Shank

Regular price $1,482.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Bloom into forever with this enchanting Flower Engagement Ring, a design that blossoms with the beauty of love in full bloom. At its center, a vivid 5 mm Round Shape Emerald gemstone sits gracefully within a delicate Flower motif, symbolizing growth, passion and the natural elegance of true romance. The unique Diamond Bypass Shank curves gently around the centerpiece, sparkling with every movement and creating a graceful flow that mirrors the intertwining paths of two souls meant to be. Exquisitely crafted for the woman who cherishes beauty in every detail, this Emerald Diamond Engagement Ring radiates charm and the poetry of everlasting love. Whether for a heartfelt proposal, a romantic anniversary or a promise of devotion, this Bypass Engagement Ring arrives beautifully presented in a signature jewelry box and is available in multiple ring sizes for the perfect fit. Romantic and full of life, this Emerald Flower Ring is a garden of emotions, forever blooming on your hand.

Product Information
SKU SHP-RINGS0821192908
Width 5 mm
Height 11.5 mm
Metal Weight 2.58 gm (Approximate)
Total Stone Weight 0.72 Carat (Approximate)
EMERALD INFORMATION
No.of Stones 1 Pieces
Total Weight 0.50 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Green
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 18 Pieces
Total Weight 0.23 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-14 Pcs
Round-1.30X1.30 mm-2 Pcs
Round-1.40X1.40 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
emerald-rings