Certified Real Diamond Floral Engagement Ring

Regular price $1,475.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Floral-Inspired Symbol of Commitment

This certified real diamond floral engagement ring is designed for those drawn to nature-inspired elegance and intricate detailing. The floral motif creates a soft, romantic presence while centering the brilliance of genuine diamonds.

Its design blends classic engagement styling with artistic form, making it a distinctive choice for proposals that value both tradition and individuality.

Floral Design and Setting Concept

The floral arrangement frames the center diamond with petal-like detailing, creating dimension and visual texture. This setting style enhances the ring’s character while keeping the overall silhouette refined and balanced.

The structure is crafted to support the diamonds securely while allowing light to interact naturally with the stones.

Certified Real Diamond Value

This ring features certified real diamonds, offering authenticity and documented quality. Certification provides assurance regarding the diamond’s characteristics and grading.

Diamonds are valued for their durability and enduring brilliance, making them a traditional and reliable choice for engagement jewelry.

High-Level Features

This engagement ring highlights a floral-inspired diamond arrangement, certified authenticity, and a balanced setting that combines decorative detailing with classic elegance. It is designed to serve as a meaningful symbol of commitment.

Product Information
SKU SHP-RINGS0621114332
Width 5.5 mm
Height 12 mm
Metal Weight 3.70 gm (Approximate)
Total Stone Weight 0.25 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 1 Pieces
Total Weight 0.25 Carat (Approximate)
Dimension(approx) Round-4X4 mm-1 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
diamond-rings

FAQs About: Certified Real Diamond Floral Engagement Ring