Certified Natural Diamond Heart Shaped Earrings with Screw Back

Regular price $900.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Designed as a quiet declaration of affection, these certified natural diamond heart shaped earrings bring romance into a refined everyday form. The open heart silhouette feels light and expressive, while a sweep of sparkling diamonds adds just enough brilliance to make the design feel meaningful without overwhelming the ear. Finished with a secure screw back closure, they make a thoughtful choice for birthdays, anniversaries, Valentine’s Day, or a personal keepsake that carries emotional value close.

Natural Diamond Heart Shaped Earrings with Screw Back

These heart stud earrings are crafted with natural diamonds in a pave setting, arranged across part of the open heart frame for a graceful balance of shine and negative space. The design includes 26 round brilliant cut diamonds with an approximate total diamond weight of 0.22 carat, offered in HI color and SI quality grade. Their compact proportions, secure backing, and choice of 92.5 sterling silver, 10K gold, 14K gold, or 18K gold in white or yellow tones make them easy to personalize for the wearer’s style.

What Makes This Special

The open heart design gives these earrings a romantic shape with a soft, airy profile. Diamonds are set along half of the heart surface, allowing the sparkle to follow the curve of the motif while keeping the overall look delicate and wearable.

Each pair features 26 round brilliant cut natural diamonds in a pave setting, with an approximate total diamond weight of 0.22 carat. The earrings measure approximately 8.7 mm in length, 8.1 mm in width, and 2.2 mm in height, creating a neat stud size that sits comfortably for daily styling or occasion wear.

The screw back closure adds a practical advantage, helping the earrings stay secure through long days, special celebrations, and regular rotation in a fine jewelry collection.

Why Choose This Design

A heart motif carries instant emotional recognition, but the open frame keeps the design modern and light on the ear. The round brilliant diamonds bring lively sparkle, while the pave setting allows the stones to sit closely together for a refined shimmer along the curve. This makes the earrings versatile enough for casual outfits, office styling, and evening dressing, while still feeling personal enough for a meaningful gift.

Design Meaning

The heart shape is a classic symbol of love, affection, and devotion. In this design, the open heart suggests sincerity and emotional openness, while the diamond-set curve adds a bright expression of celebration. Whether chosen for a partner, a family member, or as a self-gift, these earrings carry a message of care in a form that feels easy to wear and deeply personal.

Authenticity & Craftsmanship

Rosec Jewels crafts each pair with close attention to stone placement, setting security, and final finish. The natural diamonds are inspected for quality, the pave setting is reviewed for secure hold, and the earrings undergo finishing inspection before dispatch. A Certificate of Authenticity is offered with the jewelry for added confidence. To preserve their shine, store the earrings separately, avoid harsh chemicals, and clean them gently with a soft cloth as part of regular jewelry care.

Style and Wearability

With their petite heart outline and soft diamond shimmer, these screw back studs are easy to pair with everyday chains, diamond pendants, tennis bracelets, or other minimal earrings. The design sits close to the ear, making it suitable for regular wear while still carrying enough sentiment for gifting moments. Choose 92.5 sterling silver for a bright classic look, or select from 10K, 14K, or 18K white or yellow gold options to match the wearer’s preferred metal tone.

Product Information
SKU SHP-EARRINGS032211384
Length 8.7 mm
Width 8.1 mm
Height 2.2 mm
Weight 2.10 gm (Approximate)
Center Stone Weight 0.22 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 26 Pieces
Total Weight 0.22 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-2 Pcs
Round-0.90X0.90 mm-6 Pcs
Round-1.10X1.10 mm-6 Pcs
Round-1.30X1.30 mm-2 Pcs
Round-1.60X1.60 mm-2 Pcs
Round-1X1 mm-8 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade SI
View More

Product Parent Collection Handle
stud-earrings

FAQs About: Certified Natural Diamond Heart Shaped Earrings with Screw Back

What makes these diamond heart earrings a meaningful gift?

The heart shape gives the earrings a clear message of love and affection, while the natural diamonds add a celebratory sparkle. Their compact stud size and secure screw back closure make them thoughtful for birthdays, anniversaries, holidays, or a personal milestone gift.

What type of diamonds are used in these earrings?

These earrings are set with 26 natural round brilliant cut diamonds. The diamonds have an approximate total weight of 0.22 carat, with HI color and SI quality grade.

How are the diamonds set in the heart design?

The diamonds are arranged in a pave setting along part of the open heart frame. This setting style keeps the stones close together, creating a fine line of sparkle that follows the heart’s curve.

Do these earrings have a secure closure?

Yes. These heart stud earrings are designed with screw back closures, which help keep them comfortably and securely in place during wear.

What metal options are available for these earrings?

The earrings are available in 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold.

Do these certified diamond earrings come with authenticity assurance?

Yes. Rosec Jewels offers a Certificate of Authenticity with the jewelry, and each pair goes through stone inspection, setting security review, and finishing inspection before dispatch.

Are these heart shaped earrings suitable for daily wear?

The stud profile, secure screw back closure, and balanced 8.7 mm by 8.1 mm approximate size make them suitable for regular wear. For lasting shine, store them separately, avoid harsh chemicals, and clean gently with a soft cloth.