Certified Moissanite Star Ear Crawler Earring

Regular price $992.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This Ear Crawler Earring brings a touch of sparkle and unique style to any jewelry collection. Designed with a three star motif, each Star Earring is adorned with round cut moissanite stones set in a delicate pave setting, creating a continuous shimmer that catches the light beautifully. The design curves naturally along the ear, adding a modern and celestial feel that works for both everyday wear and special occasions. The flat back closure ensures a secure fit, making the Celestial Earring comfortable for helix, cartilage, or upper lobe piercings. Lightweight and easy to wear, the design stays in place while maintaining a stylish, eye-catching look. Each stone is carefully placed to maximize brilliance, giving the Moissanite Cartilage Earring a refined and elegant appeal without feeling overdone. Perfect for adding a subtle yet striking sparkle, the ear climber earring combines simplicity with creativity. Its celestial theme adds a playful, modern twist, while the D-VS1 quality moissanites provide a steady shimmer that enhances any outfit.

Product Information
SKU SHP-BODYJ0921396971
Length 16 mm
Width 6 mm
Height 2.2 mm
Metal Weight 1.00 gm (Approximate)
Total Stone Weight 0.18 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 18 Pieces
Total Weight 0.18 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-18 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
helix-earrings