Certified Moissanite Snowflake Pendant Necklace for Her

Regular price $659.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Snowflake Design with Refined Brilliance

This certified moissanite snowflake pendant in gold captures the symmetry and delicacy of a snow-inspired motif. The structured layout of stones forms a balanced pattern, creating a radiant focal point that reflects light from multiple angles.

The design offers a graceful silhouette that feels festive yet suitable for year-round wear.

Structured Setting with Gold Craftsmanship

The snowflake arrangement is carefully composed to maintain proportion and visual clarity. Each moissanite is positioned to enhance the overall symmetry while preserving a clean outline.

Crafted in gold, the pendant offers a warm contrast to the bright brilliance of moissanite, resulting in a refined finish.

Certified Moissanite Quality

Moissanite is valued for its high brilliance and durability, making it suitable for regular wear in pendant form. Certification provides documented grading details to support transparency and purchase confidence.

Moissanite is created without traditional mining, though environmental impact varies by production and energy source.

High-Level Features

This pendant features a certified moissanite snowflake design set in gold. The composition emphasizes symmetry, structured sparkle, and a versatile aesthetic that complements both seasonal styling and everyday elegance.

Product Information
SKU SHP-PENDANT032213959
Length 22 mm
Width 13.2 mm
Weight 3.36 gm (Approximate)
Center Stone Weight 1.17 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 13 Pieces
Total Weight 1.17 Carat (Approximate)
Dimension(approx) Round-2.50X2.50 mm-13 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-necklaces

FAQs About: Certified Moissanite Snowflake Pendant in Gold

What makes a snowflake pendant design unique?
A snowflake design features symmetrical, radiating elements that create a delicate and intricate appearance inspired by natural patterns.
Is moissanite suitable for everyday pendant wear?
Moissanite is a durable gemstone with strong brilliance, making it suitable for daily wear when handled and cleaned with care.
What does moissanite certification indicate?
Certification provides documented grading details regarding the gemstone’s measurable characteristics, offering added transparency.
Can this pendant be worn beyond seasonal occasions?
The refined symmetry and balanced sparkle allow the snowflake motif to complement both festive and everyday outfits.
Does the gold setting influence the overall look?
The gold setting provides warmth and contrast, enhancing the brightness of the moissanite while maintaining a cohesive design.