Certified Moissanite Lotus Flower Bridal Ring Set

Sale price $581.00 Regular price $668.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Symbolic Bridal Ring Set

The certified moissanite lotus flower bridal ring set is designed for those who value symbolism as much as structure. Inspired by the form of a lotus, this set reflects renewal and commitment, making it a meaningful choice for engagement and wedding wear.

Created as a coordinated bridal set, the rings are composed to sit together in visual harmony while still maintaining their individual character.

Lotus-Inspired Design & Setting

The lotus flower motif is integrated into the ring’s structure, adding dimension and intentional detailing to the center setting. This design approach frames the stone while giving the overall silhouette a distinctive presence on the hand.

The coordinated band is shaped to complement the engagement ring, supporting a balanced fit when worn together and a cohesive bridal look.

Certified Moissanite Center Stone

The bridal set features a certified moissanite center stone, evaluated according to recognized grading standards. Moissanite is appreciated for its brilliance and durability, making it suitable for rings intended for regular wear.

Created without traditional mining, moissanite provides an alternative center stone option. Environmental impact varies by production and energy source.

High-Level Features

  • Certified moissanite center stone
  • Lotus flower-inspired engagement ring design
  • Coordinated bridal ring set
  • Designed for engagement and wedding wear
Product Information
SKU SHP-RINGS012210387
Width 2.9 mm
Height 10.7 mm
Metal Weight 4.30 gm (Approximate)
Center Stone Weight 0.80 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 27 Pieces
Total Weight 1.03 Carat (Approximate)
Dimension(approx) Pear-5X7 mm-1 Pcs
Round-1.40X1.40 mm-2 Pcs
Round-1.30X1.30 mm-2 Pcs
Round-1.20X1.20 mm-4 Pcs
Round-1.10X1.10 mm-6 Pcs
Round-1X1 mm-4 Pcs
Round-0.90X0.90 mm-6 Pcs
Round-0.80X0.80 mm-2 Pcs
Color White
Cut Brilliant
Shape Pear, Round
Setting Type Bezel Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
bridal-sets-engagement-rings
What is included in this bridal ring set?
This product includes a coordinated engagement ring and matching band. Please refer to the product detail tables for complete specifications.
What does certified moissanite mean?
Certified moissanite has been assessed by a recognized laboratory to confirm its characteristics according to established grading standards.
Is moissanite suitable for everyday bridal wear?
Moissanite is known for its durability and can be suitable for daily wear when set securely and maintained with proper care.
Can the rings be worn separately?
Yes, the engagement ring and band can be worn together as a set or individually depending on personal preference.
Does the lotus design affect comfort?
The lotus detailing is incorporated into the setting structure while maintaining a balanced profile intended for comfortable wear.