Certified Moissanite Heart Cartilage Earring

Sale price $734.00 Regular price $843.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Delicate Design for Everyday Expression

This moissanite heart cartilage earring is crafted for those who prefer subtle yet meaningful jewelry. Designed specifically for upper ear piercings, it offers a refined way to add personality without overwhelming your overall look.

Its compact form and thoughtful detailing make it suitable for both standalone styling and curated ear combinations.

Heart Motif with Modern Minimalism

The heart shape is interpreted in a clean and understated way, allowing it to feel contemporary rather than ornate. This makes it versatile across different aesthetics, from minimal everyday wear to layered ear styling.

The design balances softness with precision, ensuring it remains visually appealing without appearing overly decorative.

Made for Cartilage Placement

Unlike traditional earrings, this piece is proportioned for cartilage wear, offering a secure and comfortable fit for upper lobe or helix piercings. Its size and structure are intended to sit neatly without shifting during daily movement.

This makes it a practical choice for consistent wear throughout the day.

Moissanite for Subtle Brilliance

The moissanite accent introduces a controlled sparkle that enhances the overall design without overpowering it. Its brilliance complements the compact heart form, adding light reflection in a refined way.

Moissanite is created without traditional mining, though impact varies by production and energy source.

Balanced for Comfort and Stability

The earring is designed to remain stable while worn, helping it stay aligned with the piercing position. Its construction focuses on ease of wear, ensuring it does not feel bulky or intrusive.

This makes it suitable for extended wear across different daily routines.

Versatile for Curated Ear Styling

Whether worn alone or combined with other studs and hoops, this piece adapts easily to different ear styling preferences. Its understated design allows it to complement both bold and minimal jewelry combinations.

It works equally well as a focal accent or a supporting element in a layered look.

A Thoughtful Alternative to Standard Studs

This cartilage earring offers a more expressive option compared to basic studs, without sacrificing simplicity. Its heart motif adds a subtle emotional element while maintaining a clean and wearable design.

The result is a piece that feels personal, modern, and easy to incorporate into everyday styling.

Product Information
SKU SHP-BODYJ0921397046
Weight 0.90 gm (Approximate)
MOISSANITE INFORMATION
No.of Stones 15 Pieces
Total Weight 0.50 Carat (Approximate)
Dimension(approx) Heart-3X3 mm-1 Pcs
Round-1.50X1.50 mm-14 Pcs
Color White
Cut Brilliant
Shape Heart, Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
cartilage-earrings

Faq About: Certified Moissanite Gold Heart Cartilage Earring

Is this earring suitable for cartilage piercings?
Yes, it is specifically designed for cartilage placements such as the upper lobe or helix.
Can I wear this earring every day?
The design focuses on comfort and stability, making it suitable for regular wear with proper care.
Is this sold as a single earring or a pair?
Please refer to the product details section on the page to confirm whether it is sold individually or as a pair.
How secure is the fit for daily use?
The earring is designed to sit securely in place, helping reduce movement during normal activities.
Does the moissanite provide noticeable sparkle?
Yes, moissanite offers a subtle brilliance that enhances the design without appearing overly flashy.
Can this be paired with other earrings?
Its minimal design makes it easy to combine with other studs, hoops, or cartilage pieces for a layered look.