Certified Moissanite Geometric Wedding Band

Sale price $501.00 Regular price $576.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Bold symmetry meets timeless sparkle in this Moissanite Half Eternity Band, a stunning piece that redefines elegance with a modern edge. Designed for the contemporary bride or style-savvy woman, this Stackable Ring features an eye-catching pattern of alternating square and round geometric shapes, each housing a brilliant round cut moissanite that radiates fire and brilliance from every angle. The moissanite stones, known for their D color and VS1 clarity, are ethically sourced and offer a dazzling alternative to traditional diamonds. Each stone is securely nestled in its own geometric frame, creating a mesmerizing sequence of light and form that flows seamlessly across the Eternity Wedding Band. This Moissanite Wedding Band beautifully captures the idea of everlasting love while leaving room for comfort and flexibility. Its stackable style makes it a versatile addition to your jewelry collection, whether worn solo for a minimalist look, paired with an engagement ring, or stacked with other bands for a bold, layered statement. Crafted with attention to detail and designed for both visual impact and everyday wear, this Anniversary Ring is a celebration of individuality and enduring connection.

Product Information
SKU SHP-RINGS122035844
Width 1.8 mm
Height 2.7 mm
Metal Weight 2.30 gm (Approximate)
Total Stone Weight 0.66 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 11 Pieces
Total Weight 0.66 Carat (Approximate)
Dimension(approx) Round-2X2 mm-11 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Bezel Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-rings