Certified Moissanite Floral Cluster Cartilage Earring

Sale price $718.00 Regular price $826.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Add some extra shine to your ear game with these Moissanite Flower Earrings, crafted to dazzle from every angle. The floral design features a cluster of round cut Moissanite stones, artfully arranged with a V shaped metal motif. Each stone is securely set in a prong setting. This chic piece is perfect for making a statement without being heavy or uncomfortable. Its compact size is great for helix, cartilage, or upper lobe piercings, allowing you to wear it solo or mix it with other earrings for a layered vibe. Whether you are aiming for a subtle shimmer or a bolder look, this Flower Cartilage Earring easily matches your mood. Made for all-day comfort, the Moissanite Helix Earring has a flat back closure that sits smoothly against your skin and stays put. Lightweight and easy to wear, it is perfect for daily wear as well as special events. A lovely option for anyone who appreciates modern ear jewelry with a feminine flair, this Flower Stud Earring brings charm, sparkle, and personality to your collection.

Product Information
SKU SHP-BODYJ0921397020
Length 7.4 mm
Width 6.4 mm
Height 2 mm
Metal Weight 0.70 gm (Approximate)
Total Stone Weight 0.24 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 4 Pieces
Total Weight 0.24 Carat (Approximate)
Dimension(approx) Round-2X2 mm-4 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
cartilage-earrings