Certified Moissanite Evil Eye Necklace and Earrings Set

Regular price $917.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Looking for something stylish with a deeper meaning? This Evil Eye Necklace Set is the perfect mix of sparkle and symbolism. Designed around the classic evil eye motif, this Moissanite Pendant Set is believed to represent protection, positivity, and good energy - making it more than just a beautiful accessory. The necklace features an evil eye design with a dazzling moissanite center stone secured in bezel setting. Around it is an open circle frame, studded with small moissanite stones that add extra brilliance and detail. The pendant hangs gracefully from a cable chain, making it easy to style with both casual and dressy outfits. The matching hoop drop earrings mirror the same evil eye design. Each charm hangs from a hinged hoop that is also adorned with shimmering moissanite stones, giving the Necklace and Earrings Set a balanced and elegant look. The eternity-inspired pattern symbolizes continuity and endless protection, adding even more meaning to the design. This Evil Eye Jewelry Set is perfect for everyday wear but also stylish enough for parties, dinners, or special events. Trendy yet meaningful, this Moissanite Evil Eye Set is designed to keep you shining while surrounding you with positive vibes.

Product Information
SKU SHP-PENDANT052179867
Length 24.5 mm
Width 17.5 mm
Metal Weight 8.40 gm (Approximate)
Total Stone Weight 2.04 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 121 Pieces
Total Weight 2.04 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-26 Pcs
Round-1.50X1.50 mm-32 Pcs
Round-1X1 mm-60 Pcs
Round-3X3 mm-2 Pcs
Round-4X4 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Bezel-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-necklaces