Certified Moissanite and Cat Pendant

Regular price $606.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Symbolic Pendant with Personal Meaning

This moissanite cat pendant is designed for those who value jewelry with character and personal expression. The cat motif offers a distinctive silhouette while maintaining a refined and balanced appearance.

It serves as a subtle yet meaningful accessory suitable for daily wear.

Thoughtful Design with Defined Form

The pendant is crafted to highlight the contours of the cat design while maintaining structural clarity. Its form allows for easy pairing with different chain styles, ensuring versatility in wear.

The arrangement of elements creates a balanced composition that remains visually engaging without being overwhelming.

Moissanite with Controlled Brilliance

Moissanite is selected for its consistent clarity and light reflection, offering a refined level of brilliance that complements the design. Its presence enhances the pendant without overshadowing its overall form.

The stone is created without traditional mining, though impact varies by production and energy source.

Designed for Everyday Wear

This pendant is suitable for regular wear, offering a balance between design and practicality. Its lightweight structure allows it to be worn comfortably throughout the day.

It can be styled alone or layered with other pieces for a personalized look.

Product Information
SKU SHP-PENDANT072210170
Length 23.5 mm
Width 10.8 mm
Weight 2.85 gm (Approximate)
Center Stone Weight 0.10 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 25 Pieces
Total Weight 0.10 Carat (Approximate)
Dimension(approx) Round-1X1 mm-25 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-necklaces

FAQs About: Certified Moissanite and Cat Pendant

Is this pendant suitable for daily wear?
Yes, its lightweight and balanced design makes it suitable for everyday wear with proper care.
What does the cat design symbolize?
The cat motif is often associated with independence, curiosity, and personal expression.
Is moissanite a durable stone for jewelry?
Moissanite can be worn regularly with proper care, helping maintain its clarity and brilliance over time.
Can this pendant be layered with other necklaces?
Yes, its design allows it to be layered with other necklaces for a more personalized styling approach.
Does the pendant include a chain?
Please refer to the product details table to confirm whether a chain is included with the pendant.
How should this pendant be cared for?
Clean gently with a soft cloth, avoid harsh chemicals, and store separately to maintain its finish and stone.