Certified Marquise Moissanite Lotus Flower Earring for Helix Piercing

Regular price $938.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Lotus-Inspired Helix Earring with Refined Detail

The Certified Marquise Moissanite Lotus Flower Earring for Helix Piercing brings together symbolic design and precise craftsmanship. Inspired by the lotus motif, it offers a balanced blend of elegance and individuality for curated ear styling.

This piece is well suited for those who prefer distinctive yet refined jewelry for cartilage piercings.

Marquise Arrangement with Contoured Fit

The marquise-shaped stones are arranged to form the lotus silhouette, creating a structured yet fluid design. This arrangement enhances the overall shape while maintaining a lightweight feel.

Designed for helix placement, the earring follows the natural contour of the ear, helping ensure a secure and comfortable fit throughout the day.

Moissanite for Brightness and Modern Appeal

Moissanite is valued for its light-reflecting qualities and clarity, offering a bright appearance suitable for everyday jewelry. It is created without traditional mining, though its environmental impact varies by production and energy source.

The marquise cut enhances the visual length and brilliance, contributing to the refined aesthetic of the lotus design.

High-Level Features Buyers Appreciate

The floral-inspired structure combined with the elongated marquise shapes creates a distinctive look that works well in both minimal and layered ear styling. It can be worn as a standalone piece or paired with other earrings for a curated effect.

Its balanced construction makes it suitable for regular wear while maintaining a unique visual identity.

Product Information
SKU SHP-BODYJ0921397161
Length 7.5 mm
Width 8.5 mm
Height 3 mm
Metal Weight 0.89 gm (Approximate)
Total Stone Weight 0.61 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 10 Pieces
Total Weight 0.61 Carat (Approximate)
Dimension(approx) Marquise-2.50X5.00 mm-3 Pcs
Round-1.70X1.70 mm-1 Pcs
Round-0.80X0.80 mm-6 Pcs
Color White
Cut Brilliant
Shape Marquise, Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
cartilage-earrings

FAQs About: Certified Marquise Moissanite Lotus Flower Earring for Helix Piercing

Is this earring suitable for helix piercings?
Yes, it is specifically designed for helix placement and follows the natural contour of the ear.
What makes the lotus design unique?
The lotus motif symbolizes balance and renewal, while the marquise arrangement adds structure and visual elegance.
Can this earring be worn daily?
Yes, its lightweight and balanced design makes it suitable for everyday wear.
Is moissanite a durable gemstone?
Moissanite is considered durable for regular use, though proper care helps maintain its appearance over time.
Does this earring pair well with other styles?
Yes, it complements both minimal studs and other helix pieces for a layered ear styling look.
Who is this earring ideal for?
It is ideal for those who prefer symbolic, floral-inspired designs with a modern structure.