Certified Lab Grown Diamond Religious Cross Earrings

Regular price $603.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Meaningful Expression in Fine Jewelry

These certified lab grown diamond religious cross earrings are designed for those who value both symbolism and refined craftsmanship. The cross motif carries personal and spiritual significance, making this pair suitable for everyday wear as well as meaningful occasions.

Their understated design ensures they complement a wide range of personal styles without overpowering the overall look.

Balanced Design with Lasting Appeal

The cross structure is carefully proportioned to maintain visual clarity while allowing each element to contribute to the overall brilliance. This thoughtful layout enhances the appearance of the diamonds while preserving a clean and structured silhouette.

It results in a design that feels both timeless and relevant for modern wear.

Comfortable for Daily Use

Designed with wearability in mind, these earrings are crafted to sit securely and comfortably throughout the day. Their balanced construction ensures they remain stable, making them suitable for extended wear without discomfort.

This makes them an easy choice for regular use across different settings.

Lab Grown Diamond as a Centerpiece

Lab grown diamonds are selected for their clarity and consistent brilliance, offering a refined appearance that aligns with modern jewelry preferences. Their structure makes them suitable for everyday jewelry pieces where durability is important.

These diamonds are created without traditional mining, and their impact varies by production and energy source.

Versatile Styling Possibilities

The cross design allows these earrings to be worn as a subtle statement or layered with other pieces for a more expressive look. Their versatility makes them suitable for both minimal and more styled ensembles.

They transition easily from casual wear to more formal settings.

A Thoughtful Gift with Symbolism

With their meaningful design and refined finish, these earrings are a considered gifting option. They are suitable for occasions where symbolism and personal connection matter, offering a piece that holds both visual and emotional value.

The design ensures lasting relevance beyond trends.

Product Information
SKU SHP-EARRINGS022510048
Weight 1.76 gm (Approximate)
Center Stone Weight 0.27 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 23 Pieces
Total Weight 0.27 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-21 Pcs
Round-2.50X2.50 mm-2 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More

Product Parent Collection Handle
lab-created-emerald-earrings

Faq About: Certified Lab Grown Diamond Religious Cross Earrings

Are these earrings suitable for everyday wear?
Yes, they are designed for regular use with a balanced structure that ensures comfort and stability throughout the day.
What does the cross design represent?
The cross is a symbolic design often associated with faith, making these earrings meaningful for personal or spiritual expression.
Will the earrings feel heavy on the ears?
The design is crafted to maintain a lightweight feel while providing a structured and balanced appearance.
Can these earrings be paired with other jewelry?
Yes, their clean and minimal design allows them to pair easily with other pieces without overwhelming the overall look.
What makes lab grown diamonds a practical choice?
Lab grown diamonds offer consistent brilliance and durability, making them suitable for everyday jewelry.
Are these earrings suitable as a gift?
Yes, their symbolic design and timeless appeal make them a thoughtful gifting option for meaningful occasions.