Certified Lab Grown Diamond Nature Inspired Necklace

Regular price $739.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Nature-Inspired Refinement in a Diamond Necklace

This certified lab grown diamond nature inspired necklace is created for buyers seeking a piece that blends subtle organic design with refined quality. The silhouette is intended to evoke natural forms while presenting a composed and elegant profile suitable for both everyday wear and elevated occasions.

The design balances visual appeal with a calm, understated presence, making it suitable for gifting, personal milestones, or complementing wardrobe choices focused on thoughtful detail.

Design Purpose & Setting

The setting highlights the nature-inspired motif while maintaining the central diamond’s clarity and luster. Functional design considerations support a secure setting and ensure the necklace sits comfortably without compromising visual coherence.

Lab Grown Diamond Consideration

Lab grown diamonds are created without traditional mining and are commonly chosen for their suitability in fine jewelry. Their long-term impact varies based on production methods and energy source, and they retain the structural qualities expected in daily-wear necklaces.

High-Level Features

  • Certified lab grown diamond nature inspired design
  • Refined necklace silhouette for versatile wear
  • Designed to balance everyday comfort with visual detail
  • Suitable as a meaningful gift or personal staple piece
Product Information
SKU SHP-PENDANT022510059
Metal Weight 3.50 gm (Approximate)
Total Stone Weight 0.56 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 44 Pieces
Total Weight 0.56 Carat (Approximate)
Dimension(approx) Round-2.10X2.10 mm-4 Pcs
Round-1.30X1.30 mm-40 Pcs
Color E-F
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade VS
View More
What does "certified" mean for this diamond necklace?
Certification indicates that the diamond’s quality attributes have been evaluated and documented by a recognized grading authority.
Is this necklace designed for daily wear?
The necklace is designed to be worn regularly when used as intended and maintained with proper care.
What makes the design "nature inspired"?
The design draws on organic visual cues, integrating forms that evoke natural shapes into a refined jewelry piece.
Are metal options available on this page?
Available metal options and specifications are provided in the product detail tables on the page.
How should this necklace be cared for?
Regular gentle cleaning and proper storage will help maintain the necklace’s appearance over time.