Certified Lab Grown Diamond Aries Astrology Necklace

Sale price $580.00 Regular price $667.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Zodiac Necklace with Personal Meaning

The Certified Lab Grown Diamond Aries Astrology Necklace is designed for those who connect deeply with their zodiac identity. Representing Aries, this piece blends symbolic expression with refined craftsmanship, creating a necklace that feels both personal and elegant. Its design is suited for everyday wear while remaining distinctive enough to stand on its own.

Whether chosen as a birthday gift, a milestone keepsake, or a personal talisman, this necklace offers a thoughtful way to celebrate individuality through fine jewelry.

Design & Zodiac Detailing

The Aries motif forms the central visual element, carefully shaped to reflect the bold and confident spirit traditionally associated with this sign. Diamonds are integrated into the design to provide subtle brilliance without overpowering the symbolic form. The overall structure maintains a balanced profile that rests comfortably when worn.

The necklace is crafted to complement both minimal styling and layered looks, making it adaptable across occasions and personal aesthetics.

Lab Grown Diamond Value

The diamonds used in this necklace are lab grown and certified. Lab grown diamonds are created without traditional mining, and their environmental impact varies by production and energy source. They offer the same fundamental properties as mined diamonds, including durability suitable for regular wear and enduring brilliance.

High-Level Features

This Aries astrology necklace combines personal symbolism with certified lab grown diamonds and a refined silhouette. It is designed to be meaningful yet versatile, appropriate for daily styling while retaining the sentiment of a zodiac-inspired piece.

Product Information
SKU SHP-PENDANT0921397819
Length 18 mm
Width 19.5 mm
Metal Weight 3.04 gm (Approximate)
Total Stone Weight 0.29 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 36 Pieces
Total Weight 0.29 Carat (Approximate)
Dimension(approx) Round-1.60X1.60 mm-1 Pcs
Round-1.40X1.40 mm-1 Pcs
Round-1.20X1.20 mm-29 Pcs
Round-1.10X1.10 mm-4 Pcs
Round-1X1 mm-1 Pcs
Color E-F
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade VS
View More

Product Parent Collection Handle
aries-zodiac-sign-jewelry

FAQs About: Lab Grown Diamond Aries Astrology Necklace

What does the Aries symbol represent in this necklace?
The Aries symbol traditionally represents qualities such as confidence, initiative, and leadership, making it a meaningful choice for those born under this zodiac sign.
Are the diamonds in this Aries necklace certified?
Yes, the necklace features certified lab grown diamonds, offering documented quality standards for the stones used in the design.
Is a lab grown diamond suitable for everyday wear in a necklace?
Lab grown diamonds have the same fundamental hardness and durability as mined diamonds, making them appropriate for regular necklace wear with proper care.
Can this Aries astrology necklace be given as a birthday gift?
A zodiac necklace is often selected as a birthday gift, especially for someone who values personal symbolism and astrology-inspired jewelry.
Does the design work well for layering with other necklaces?
The refined silhouette and balanced proportions allow it to be worn alone or layered with other chains for a personalized styling approach.