Certified Lab Grown Diamond 3 Row Wedding Band

Sale price $672.00 Regular price $772.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Layered Brilliance in a Structured Band

This Certified Lab Grown Diamond 3 Row Wedding Band is crafted for those who prefer a bold yet refined expression of commitment. The three-row arrangement creates visual depth, offering continuous sparkle across the band’s surface.

Its structured design makes it suitable as a statement wedding band or as a complement to an engagement ring.

Three-Row Design with Balanced Symmetry

The triple-row layout enhances light reflection from multiple angles, creating a layered effect without overwhelming the finger. Each row works together to produce a uniform, cohesive appearance.

This configuration delivers presence while maintaining an elegant and balanced silhouette.

Lab Grown Diamond Brilliance

Lab grown diamonds offer the same visual and physical characteristics as mined diamonds, making them suitable for everyday wear. Their consistent sparkle enhances the structured three-row setting.

Lab grown diamonds are created without traditional mining, though impact varies by production and energy source.

High-Level Features

This wedding band features a three-row design set with certified lab grown diamonds. The band emphasizes layered brilliance, structured alignment, and versatile styling suitable for pairing or standalone wear.

Product Information
SKU SHP-RINGS062510074
Metal Weight 3.44 gm (Approximate)
Total Stone Weight 0.64 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 59 Pieces
Total Weight 0.64 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-34 Pcs
Round-1X1 mm-25 Pcs
Color E-F
Cut Brilliant
Shape Round
Setting Type Pave Setting
Quality Grade VS
View More

FAQs About: Certified Lab Grown Diamond 3 Row Wedding Band

Can this 3 row wedding band be worn alone?
Yes, the multi-row design provides substantial sparkle, making it suitable as a standalone wedding band.
Does a three-row band sit comfortably on the finger?
A properly crafted three-row band is designed for balanced weight distribution to support comfortable wear.
Can this band be paired with an engagement ring?
Yes, it can complement various engagement ring styles, though fit and alignment should be considered based on the ring’s profile.
Are lab grown diamonds durable for daily wear?
Lab grown diamonds share the same hardness and durability as mined diamonds, making them appropriate for everyday jewelry.
How should I maintain a multi-row diamond band?
Clean gently with mild soap and lukewarm water using a soft brush, ensuring residue does not build up between the rows.