Certified Heart Shape Moissanite Key Necklace for Women

Sale price $568.00 Regular price $653.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Turn a familiar symbol of love into a wearable message with this certified Moissanite Key to My Heart necklace for women. A brilliant heart-shaped Moissanite sits within the romantic key design, while the bow repeats the heart motif for a cohesive look. Whether chosen for a partner, an anniversary, birthday, milestone, or personal keepsake, this heart key necklace carries an unmistakable message of affection.

Heart Shape Moissanite Key Necklace

The necklace centers on one white heart-shaped Moissanite measuring approximately 5 x 5 mm and weighing about 0.55 carat. Brilliant-cut faceting and a D-VS1 quality grade give the stone its bright appearance, while a three-prong setting keeps the heart clearly visible within the key motif. The confirmed version is crafted in 92.5 sterling silver with an approximate metal weight of 4.50 grams and can be selected with an 18-inch chain or without a chain.

What Makes This Heart Shape Moissanite Key Necklace Special

  • One approximately 0.55 carat white Moissanite forms the sparkling focal point.
  • Heart-shaped center stone measures approximately 5 x 5 mm.
  • D-VS1 quality with brilliant-cut faceting for crisp sparkle.
  • Three-prong setting keeps the heart-shaped Moissanite visually open.
  • Key-shaped pendant incorporates a coordinating heart motif within the bow.
  • Crafted in 92.5 sterling silver and selected yellow rose or white gold options in 10K, 14K, and 18 with an approximate metal weight of 4.50 grams.
  • Available with an 18-inch chain or without a chain.

Why Choose a Moissanite Key to My Heart Necklace

The combination of a key and heart gives this necklace meaning beyond its sparkle. A key-to-the-heart motif traditionally expresses affection and emotional closeness, making the design especially fitting for romantic gifting, birthdays, anniversaries, graduations, or important new chapters. The single heart-shaped Moissanite keeps that symbolism clear, while the key silhouette adds personality without requiring a heavily embellished design.

Certified Moissanite Necklace Craftsmanship & Authenticity

Rosec Jewels crafts this Moissanite key necklace with attention to stone placement, three-prong security, defined heart-and-key detailing, and refined finishing. Rosec Jewels offers a Certificate of Authenticity with its jewelry for added purchase confidence. Pieces also go through stone inspection, setting security review, and finishing inspection before dispatch, with care guidance supporting responsible long-term ownership.

Styling a Moissanite Heart Key Necklace for Women

The heart-shaped stone creates a bright focal point within the longer key silhouette, giving the necklace enough character to wear alone while remaining easy to pair with small studs, slim bracelets, or other silver-toned jewelry. Choose the 18-inch chain option for a ready-to-wear necklace, or select the pendant without a chain when you prefer to style it with a compatible chain of your own. Its romantic symbolism makes it particularly suited to anniversary, birthday, Valentine's, milestone, and just-because gifting.

Product Information
SKU SHP-PENDANT032214178
Metal Weight 4.50 gm (Approximate)
Total Stone Weight 0.55 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.55 Carat (Approximate)
Dimension(approx) Heart-5X5 mm-1 Pcs
Color White
Cut Brilliant
Shape Heart
Setting Type 3-Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
key-necklaces

FAQs About: Certified Moissanite Key to My Heart Necklace for Women

What size and quality is the heart-shaped Moissanite in this key necklace?

The necklace features one white heart-shaped Moissanite measuring approximately 5 x 5 mm and weighing about 0.55 carat. It has brilliant-cut faceting and a D-VS1 quality grade.

What setting is used for the heart shape Moissanite?

The 5 mm heart-shaped Moissanite is secured in a three-prong setting. This keeps the heart outline clearly visible while positioning the stone as the main sparkling detail within the key design.

What does the Key to My Heart necklace symbolize?

The key-and-heart motif represents affection and the idea of holding the key to someone's heart. That symbolism makes the necklace especially meaningful for romantic gifting, anniversaries, birthdays, and other relationship milestones.

Does this Moissanite key pendant come with a chain?

The pendant can be selected with an 18-inch chain or without a chain. This gives you the choice of a complete ready-to-wear necklace or the pendant alone for pairing with a compatible chain you already own.

What metal is used for this Moissanite heart key necklace?

The confirmed version is crafted in 92.5 sterling silver and selected yellow rose or white gold options in 10K, 14K, and 18 and has an approximate metal weight of 4.50 grams.

Does this certified Moissanite necklace come with a Certificate of Authenticity?

Yes. Rosec Jewels offers a Certificate of Authenticity with its jewelry for added product confidence. Pieces also go through stone inspection, setting security review, and finishing inspection before dispatch.

How should I care for a Moissanite key necklace?

Clean the necklace gently with mild soap, lukewarm water, and a soft cloth, then dry it carefully. Avoid harsh chemicals and abrasive surfaces, store it separately when it is not being worn, and handle the pendant and chain carefully to help protect the setting and finish.