Certified Diamond Half Circle Earring for Piercing

Regular price $737.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Crafted in a sleek, semi circle silhouette, this cartilage piece wraps the curve of your ear subtle sparkle, thanks to a row of precisely set diamonds that catch the light from every angle. The Diamond Half Circle Earring is perfect to elevate your piercing stack, it is embedded with dainty Round Diamonds studded on a half circle motif in pave setting. You can style this Semi Circle Earring on your multiple piercings like Helix, Cartilage, or Upper Lobe Piercing. This Diamond Piercing Earring is the perfect graduation gift for her, offering a touch of elegance and sophistication to commemorate a special occasion. Whether its for a daughter, sister, friend, or loved one, this piece of piercing jewelry is sure to be treasured for years to come. Handcrafted in premium metal with a secure flat back closure, this Cartilage Stud is as durable as it is dazzling.

Product Information
SKU SHP-BODYJ052310101
Length 9.8 mm
Width 6.6 mm
Height 1.3 mm
Metal Weight 0.30 gm (Approximate)
Total Stone Weight 0.17 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 13 Pieces
Total Weight 0.17 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-13 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade SI
View More