Certified 5 MM Lab Grown Diamond Floral Engagement Ring

Regular price $919.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Bring a touch of natures brilliance to your jewelry collection with this Diamond Flower Ring. We designed this Nature Inspired Engagement Ring for those who love minimal things with a touch of uniqueness, it features a 6 MM round cut lab grown diamond set in a safe prong setting and takes the spotlight. Encircling it is a diamond halo carefully arranged in a scalloped motif, adding a perfect amount of sparkle with floral design. The bypass shank with a diamond studded leaf gives it a graceful and modern touch. This Diamond Promise Ring comes with a certificate of guarantee for quality assurance and comes packaged in a chic, protective box, ideal for gifting or safe storage when not in use.

Product Information
SKU SHP-RINGS052410107
Metal Weight 2.80 gm (Approximate)
Center Stone Weight 0.99 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 19 Pieces
Total Weight 1.13 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-18 Pcs
Round-6X6 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More