Certified 0.8 Carat Lab Grown Black Flower Promise Ring with White Diamond

Regular price $839.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Confess your love in the most beautiful way with this Flower Promise Ring, designed to capture emotion, meaning and timeless elegance. At the center sits a 5 mm Round Shape Synthetic Black Diamond, placed within a Flower motif that symbolizes blooming affection, new beginnings and a bond that grows stronger with every shared moment. The surrounding White Diamond accents along the band add a soft sparkle, representing purity, trust and the light that love brings into life. Together, the contrast of black and white creates a powerful message, two different souls coming together to form something complete, balanced and unforgettable. The floral design adds a romantic touch inspired by nature, where every petal tells a story of care, growth and promise. This Commitment Ring for her is a heartfelt expression of commitment and the beginning of a meaningful journey together. Elegant yet modern, this Lab Grown Black Diamond Promise Ring suits someone who values simplicity with deeper symbolism. Presented in a signature jewelry box and available in multiple ring sizes, this Black and White Diamond Ring is ready to become part of a cherished memory. Perfect as a promise ring or a special token of eternal love, this piece beautifully celebrates a connection that is lasting and full of meaning.

Product Information
SKU SHP-RINGS082215818
Width 8.5 mm
Height 2.5 mm
Metal Weight 2.38 gm (Approximate)
Center Stone Weight 0.84 Carat (Approximate)
SYNTHETIC BLACK DIAMOND INFORMATION
No.of Stones 1 Pieces
Total Weight 0.84 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Black
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAAA ( Synthetic )
DIAMOND INFORMATION
No.of Stones 16 Pieces
Total Weight 0.16 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-16 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
lab-created-black-diamond-rings