Brilliant Cut Moissanite Rose Engagement Ring For Women

Sale price $581.00 Regular price $668.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Romantic and graceful, this Flower Engagement Ring brings a soft, feminine charm to a timeless design. At its center sparkles a 7 MM Round Shaped Moissanite, securely set in a delicate 6-claw prong setting that allows the stone to shine with incredible brilliance. Framing the center stone on each side is a beautifully sculpted rose flower motif, and small, shimmering stone that adds a subtle but eye-catching sparkle. Inspired by nature's beauty, the floral elements add a whimsical touch while maintaining a refined elegance, making this Moissanite Engagement Ring ideal for someone who appreciates gentle details and unique craftsmanship. The combination of the radiant Moissanite center with the floral accents creates a balanced and enchanting look that feels fresh yet timeless. Crafted with care and thoughtfulness, this Moissanite Solitaire Ring offers the brilliance of a diamond while being eco-friendly and affordable. The band is designed for all-day comfort, so it is perfect for everyday wear while still standing out during your most memorable moments. Whether it is a symbol of a blooming love or a sweet reminder of a cherished promise, this Rose Engagement Ring is designed to capture emotion in every petal and sparkle.

Product Information
SKU SHP-RINGS052187591
Width 6.5 mm
Height 8 mm
Metal Weight 3.04 gm (Approximate)
Center Stone Weight 1.36 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 3 Pieces
Total Weight 1.54 Carat (Approximate)
Dimension(approx) Round-2.50X2.50 mm-2 Pcs
Round-7X7 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type 6-Claw-Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-rings