Black Onyx Evil Eye Pendant with Moissanite Eternity Circle

Sale price $625.00 Regular price $702.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Symbolic style meets everyday wear in this Black Onyx Pendant Necklace, made for those who like jewelry with meaning. The evil eye design is known for protection and positive energy, making this piece more than just something you wear - it is something you carry with you. The design features a round cut black onyx placed within the evil eye motif, secured in bezel setting. Around it, an open circle is lined with moissanite stones, adding a nice contrast and giving the Black and White Pendant a more detailed and eye-catching look. The circular shape also represents continuity and balance, adding another layer of meaning to the design. It hangs from a chain and sits comfortably along the neckline, making it easy to pair with both everyday outfits and dressier looks. You can wear this Evil Eye Necklace on its own for a minimal vibe or layer it with another chain for a more styled look. Crafted with care and quality materials, it is made for regular wear and long-term use. A great option for gifting or personal use, this Eternity Necklace blends symbolism and style in a way that feels modern and wearable.

Product Information
SKU SHP-PENDANT052177971
Length 24.5 mm
Width 17.4 mm
Metal Weight 4.70 gm (Approximate)
Total Stone Weight 1.09 Carat (Approximate)
BLACK ONYX INFORMATION
No.of Stones 1 Pieces
Total Weight 0.22 Carat (Approximate)
Dimension(approx) Round-4X4 mm-1 Pcs
Color Black
Cut Brilliant
Shape Round
Setting Type Bezel-Setting
Quality Grade AAA
MOISSANITE INFORMATION
No.of Stones 32 Pieces
Total Weight 0.87 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-32 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Bezel-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
black-onyx-necklaces