Bezel Set Diamond Sunburst Earring for Helix Piercing

Sale price $969.00 Regular price $1,064.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Like a little ray of sunshine you can wear, this Diamond Sunburst Earring brings both sparkle and meaning in the most effortless way. At its center sits a round cut diamond in bezel setting, giving it that modern finish while also keeping the stone secure. What really makes it stand out is the half sunburst design radiating from the diamond, subtle, artistic, and just different enough to catch attention. The sun motif is not just about aesthetics. It represents warmth, energy, positivity, and new beginnings, which makes this Diamond Cartilage Earring feel a lot more personal. It is perfect for someone who loves jewelry with a story, not just something that looks pretty. The asymmetrical design gives it a unique edge, making the Diamond Helix Earring ideal for styling across multiple piercings like helix, cartilage, tragus, conch, or upper lobe. It also makes a meaningful gift - great for a mother, daughter, wife, or girlfriend. Something about the sun design just makes it feel warm and thoughtful. Finished with a flat back closure, it is comfortable enough for all-day wear. Stylish, symbolic, and easy to love.

Product Information
SKU SHP-BODYJ0921397217
Length 5.5 mm
Width 7.5 mm
Height 1.8 mm
Metal Weight 0.89 gm (Approximate)
Total Stone Weight 0.09 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 1 Pieces
Total Weight 0.09 Carat (Approximate)
Dimension(approx) Round-2.40X2.40 mm-1 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Bezel-Setting
Quality Grade SI
View More

Product Parent Collection Handle
helix-earrings