8 MM Round Solitaire Lab Grown Diamond Teardrop Necklace

Regular price $1,498.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Elevate your style with the enchanting Lab Grown Diamond Pendant featuring a Star Motif, an ideal accessory for any occasion, day or night. This Teardrop Pendant Necklace highlights an 8 MM round-shaped Synthetic Diamond of EF-VS quality securely set in prong setting, radiating brilliance. The charming Star Motif, adorned with a round diamond, brings a hint of the celestial to this exquisite piece. This Solitaire Diamond Pendant complements any outfit, whether youre dressing up or keeping it casual.

Product Information
SKU SHP-PENDANT082310791
Metal Weight 4.10 gm (Approximate)
Total Stone Weight 2.08 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 2 Pieces
Total Weight 2.08 Carat (Approximate)
Dimension(approx) Round-2.10X2.10 mm-1 Pcs
Round-8X8 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More