4 Carat London Blue Topaz Heart Drop Earrings for Women

Regular price $897.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This Valentine’s Day, make her heart race with these stunning London Blue Topaz Drop Earrings, a dazzling representation of love, affection, and everlasting beauty. Each earring features a stunning 8 MM heart shape London Blue Topaz gemstone that instantly catches the eye, secured in prong setting. The shape and color together create a look that feels both graceful and expressive. At the top of each drop, a delicate leaf-like motif adds a feminine touch to the design. This thoughtful detail makes the London Blue Topaz Heart Earrings stand out while keeping the overall look refined. Designed for comfort and security, these Heart Drop Earrings are attached to screw backs. The screw back closure helps keep them firmly in place, so you can wear them with confidence throughout the day. They feel secure and comfortable, making them suitable for long hours of wear. Perfect as a meaningful gift or a special addition to your own jewelry collection, these Solitaire Heart Earrings combine rich color, delicate detailing, and timeless style in one beautiful pair.

Product Information
SKU SHP-EARRINGS042169516
Metal Weight 1.80 gm (Approximate)
Total Stone Weight 4.10 Carat (Approximate)
LONDON BLUE TOPAZ INFORMATION
No.of Stones 2 Pieces
Total Weight 4.10 Carat (Approximate)
Dimension(approx) Heart-8X8 mm-2 Pcs
Color Blue
Cut Brilliant
Shape Heart
Setting Type 3-Prong-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
london-blue-topaz-earrings