2 Carat Round London Blue Topaz Vintage Engagement Ring with Certificate

0
Regular price $914.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This London Blue Topaz Engagement Ring is an exceptionally unique piece, crafted to enchant with its nature-inspired elegance and brilliant shine. At its core lies an 8 MM round cut London Blue Topaz, securely set in a classic double prong setting as a timeless solitaire. Surrounding this centerpiece are intricate floral engravings along the band, embellished with small Diamond stones that contribute an elegant shimmer and a hint of vintage allure. The Solitaire Engagement Ring showcases exquisite beaded detailing that enhances its graceful aesthetic, while a hidden flower motif beneath the central stone reveals a sparkling peek-a-boo stone - introducing a delightful touch of brilliance without overshadowing the stunning solitaire. Designed for those who appreciate nature and everlasting romance, this Vintage Style Ring harmoniously merges soft floral motifs with radiant sparkle. The AAA quality London Blue Topaz and HI-SI quality Diamonds reflects light beautifully, symbolizing love, commitment, and treasured memories. Ideal for brides seeking something distinctive yet timeless, this Nature Inspired Engagement Ring intertwines romance, sophistication, and a touch of old-world charm. It is a significant piece she will cherish eternally, a true homage to love in every intricate detail.

Product Information
SKU SHP-RINGS042014752
Width 6.5 mm
Height 8 mm
Metal Weight 4.78 gm (Approximate)
Center Stone Weight 2.00 Carat (Approximate)
LONDON BLUE TOPAZ INFORMATION
No.of Stones 1 Pieces
Total Weight 2.00 Carat (Approximate)
Dimension(approx) Round-8X8 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Double-Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 8 Pieces
Total Weight 0.08 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-8 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Double-Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
london-blue-topaz-rings