2 Carat Pear Shape Lab Grown Diamond Designer Engagement Ring IGI Certified

Regular price $1,457.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Wow her with this stunning Diamond Solitaire Engagement Ring, it is really the perfect choice for her. This Designer Ring is made from top-quality metal and has a 2 carat pear shaped lab grown diamond right in the center, held securely by prongs. The sides of the Teardrop Engagement Ring are decorated with tiny marquise and round diamonds, and the beautifully twisted Infinity style motif on the band represents the strong bond between two hearts. As a classic symbol of commitment, this Lab Grown Diamond Engagement Ring has a timeless look that grabs attention right away. With its deep meaning, this Unique Engagement Ring shows your special connection and tells the story of your love. Made with an IGI Certified E-VS1 Quality Pear Shaped Lab Grown Diamond, it shines with amazing clarity and brilliance, making it a perfect symbol of everlasting love. Our talented artisans have carefully crafted this 2 Carat Engagement Ring, creating a true masterpiece that she will cherish for its beautiful sparkle. This Lab Grown Diamond Ring for Women is perfect for all your important occasions, whether it is an Anniversary, Wedding, Engagement, Valentine's Day, Birthday, New Year, or Christmas. With its blend of craftsmanship and brilliant sparkle, this piece celebrates every beautiful moment along your journey.

Product Information
SKU SHP-RINGS072610319
Metal Weight 2.40 gm (Approximate)
Center Stone Weight 2.00 Carat (Approximate)
LAB GROWN DIAMOND(IGI) INFORMATION
No.of Stones 1 Pieces
Total Weight 2.00 Carat (Approximate)
Dimension(approx) Pear-11X7 mm-1 Pcs
Color E
Cut Brilliant
Shape Pear
Setting Type Prong-Setting
Quality Grade VS1
LAB GROWN DIAMOND INFORMATION
No.of Stones 6 Pieces
Total Weight 0.17 Carat (Approximate)
Dimension(approx) Round-1.40X1.40 mm-4 Pcs
Marquise-2X4 mm-2 Pcs
Color E-F
Cut Brilliant
Shape Round, Marquise
Setting Type Prong-Setting
Quality Grade VS
View More