2 Carat Lab Grown Diamond Vintage Floral Engagement Ring

Sale price $1,361.00 Regular price $1,565.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Let this Diamond Flower Engagement Ring add a touch of natures beauty to your unique style. Handcrafted from high-quality metal, this Bypass Engagement Ring has an intricate flower motif decorated with an 8 MM round cut diamond of EF-VS quality set in a secured prong setting. The floral petals and designer bypass shank are adorned with peek-a-boo diamonds, providing a sparkling appeal to the overall look without distracting an eye from the sparkling solitaire. The diamonds in this Solitaire Ring are lab-grown which means they are ethically made, responsibly sourced and provide you the same sparkle and durability as the mined ones but at a more affordable price tag. Mark the moment of love with this masterpiece and let her cherish it forever.

Product Information
SKU SHP-RINGS022510021
Metal Weight 3.10 gm (Approximate)
Center Stone Weight 2.04 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 43 Pieces
Total Weight 2.39 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-12 Pcs
Round-1.20X1.20 mm-18 Pcs
Round-1.30X1.30 mm-4 Pcs
Round-1.40X1.40 mm-8 Pcs
Round-8X8 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Floral-Setting
Quality Grade EF-VS
View More