2 Carat Lab Grown Diamond G Initial Necklace for Women

Sale price $1,698.00 Regular price $1,952.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Make personal jewelry feel unmistakably yours with this 2 Carat Lab Grown Diamond G Initial Necklace. The letter G becomes the focal point of the design, highlighted by a fancy-shaped brilliant-cut lab grown diamond for a distinctive mix of personalization and sparkle. Suspended from a cable chain, this diamond initial necklace for women can celebrate your own initial, represent someone meaningful, or become a thoughtful birthday, anniversary, Valentine's Day, friendship, or milestone gift.

2 Carat Diamond G Initial Necklace with Fancy Lab Grown Diamond

The necklace features one approximately 2.00 carat lab grown diamond in a fancy shape, measuring about 5 x 5 mm. The brilliant-cut stone is graded E-F color and VS clarity and secured in a prong setting. Crafted in 92.5 sterling silver and selected yellow or white gold options in 10K, 14K, and 18K with an approximate metal weight of 2.00 grams, the personalized G necklace is paired with an 18-inch cable chain for a complete, ready-to-wear look.

What Makes This Diamond G Initial Necklace Special

  • Approximately 2.00 carat lab grown diamond.
  • Fancy-shaped diamond measuring approximately 5 x 5 mm.
  • Brilliant cut for a light-catching finish.
  • E-F color and VS clarity.
  • Prong-set single diamond design.
  • Letter G initial motif for personal meaning.
  • Available in 92.5 sterling silver and selected yellow or white gold options in 10K, 14K, and 18K construction.
  • Approximate metal weight of 2.00 grams.
  • Supplied with an 18-inch cable chain.

The combination of an alphabet-inspired silhouette and a substantial lab grown diamond gives this initial pendant a more distinctive presence than a simple polished letter. It works as both personalized jewelry and a sparkling statement necklace while keeping the meaning centered on the initial itself.

Meaning Behind a Lab Grown Diamond Initial Necklace

An initial necklace can represent identity, a loved one's name, a meaningful surname, or a connection worth keeping close. The letter G gives this piece an intentionally personal character, while the single diamond adds emphasis without distracting from the alphabet design. That balance makes it a thoughtful choice for self-gifting, friendship, romantic occasions, birthdays, graduations, and other milestones tied to someone or something beginning with G.

Lab Grown Diamond Necklace Authenticity & Craftsmanship

Rosec Jewels crafts this diamond G necklace with attention to stone placement, prong security, chain finishing, and overall polish. A Certificate of Authenticity is offered with Rosec Jewels jewelry for added purchase confidence. Each piece goes through stone inspection, setting security review, and finishing inspection before dispatch, with care guidance provided to help maintain the diamond, precious metal, and chain over time.

G Initial Diamond Necklace for Layering & Meaningful Gifting

The personalized letter design gives this necklace enough character to wear alone while its 18-inch cable chain also makes it suitable for layering with other necklaces. The E-F color lab grown diamond brings bright contrast against the sterling silver setting, allowing the G initial to remain noticeable with everyday outfits, workwear, dinner looks, or occasion styling. Choose it as a personalized diamond necklace for yourself or as a thoughtful gift connected to a meaningful name or initial.

Product Information
SKU SHP-PENDANT022610016
Metal Weight 2.00 gm (Approximate)
Total Stone Weight 2.00 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 1 Pieces
Total Weight 2.00 Carat (Approximate)
Dimension(approx) Fancy-5X5 mm-1 Pcs
Color E-F
Cut Brilliant
Shape Fancy
Setting Type Prong-Setting
Quality Grade VS
View More

FAQs About: Lab Grown Diamond 2 Carat G Initial Necklace for Women

What diamond is used in this G initial necklace?

The necklace features one approximately 2.00 carat fancy-shaped lab grown diamond measuring about 5 x 5 mm. It has a brilliant cut, E-F color, VS clarity, and is secured in a prong setting.

What makes this 2 carat diamond G necklace personalized?

The necklace is designed around the letter G, allowing it to represent the wearer's own initial, the name of someone meaningful, a surname, or another personal connection associated with the letter.

Does the G initial necklace come with a chain?

Yes. The confirmed necklace is supplied with an 18-inch cable chain, creating a complete design that can be worn alone or incorporated into a layered necklace look.

What metal is used for this lab grown diamond initial necklace?

The confirmed necklace is crafted in 92.5 sterling silver and selected yellow or white gold options in 10K, 14K, and 18K and has an approximate metal weight of 2.00 grams.

Is a diamond G initial necklace suitable for gifting?

Yes. The letter G gives the necklace a personal connection that can suit birthdays, anniversaries, Valentine's Day, graduations, friendship gifts, self-gifting, and other meaningful milestones associated with a name or initial.

Does this lab grown diamond necklace include authenticity documentation?

Rosec Jewels offers a Certificate of Authenticity with its jewelry. The necklace also goes through stone inspection, setting security review, and finishing inspection before dispatch.

How should I care for a lab grown diamond initial necklace?

Clean the necklace gently with mild soap, lukewarm water, and a soft cloth or brush, then rinse and dry it carefully. Avoid harsh chemicals, abrasive surfaces, and strong impacts, store it separately when not in use, and periodically inspect the prong setting and cable chain for secure wear.