2 Carat Lab Grown Black and White Diamond Flower Engagement Ring

Regular price $739.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Capture the essence of blooming love with this beautifully crafted Flower Engagement Ring. At the center of the design sits an 8 mm Round Shape Synthetic Black Diamond set in Claw Setting, bold and captivating, representing strength, devotion and a love that stands firm through every season of life. On each side, a flower motif unfolds gracefully, each centered with a dainty White Diamond that adds a soft, radiant touch, symbolizing purity, hope and new beginnings. Together, the black and white stones create a striking harmony, reflecting two unique hearts growing together while staying beautifully individual. The floral design draws inspiration from the elegance of nature, where every bloom represents growth, care and a love that keeps unfolding with time. Presented in a signature jewelry box and available in a range of ring sizes, this Lab Grown Black Diamond Engagement Ring is ready to become part of your most cherished moment. Perfect as an engagement ring or a heartfelt promise of forever, this Black and White Diamond Ring celebrates a bond that is meaningful and endlessly romantic.

Product Information
SKU SHP-RINGS0821213487
Width 5.5 mm
Height 8 mm
Metal Weight 3.13 gm (Approximate)
Center Stone Weight 2.16 Carat (Approximate)
SYNTHETIC BLACK DIAMOND INFORMATION
No.of Stones 1 Pieces
Total Weight 2.16 Carat (Approximate)
Dimension(approx) Round-8X8 mm-1 Pcs
Color Black
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade AAAA ( Synthetic )
DIAMOND INFORMATION
No.of Stones 2 Pieces
Total Weight 0.05 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade SI
View More

Product Parent Collection Handle
lab-created-black-diamond-engagement-rings