2.9 Carat Lab Created Ruby and Diamond Teardrop Wedding Necklace for Bride

Sale price $1,377.00 Regular price $1,582.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Flowing with the beauty of eternal love and fiery elegance, this Lab Grown Ruby and Diamond Necklace is a breathtaking symbol of romance and sophistication. It features a stunning 7X10 MM pear shaped lab created ruby suspended beneath a radiant infinity motif. Its elegant teardrop silhouette enhances the gemstone’s brilliance, while the prong setting allows light to reflect beautifully. Above the mesmerizing ruby rests a beautifully crafted infinity design adorned with shimmering round diamond stones. Symbolizing endless love and eternal connection, the infinity motif adds a graceful and meaningful touch to the pendant’s luxurious design. More sparkling diamonds surrounding both the center stone create a dazzling halo of brilliance, enhancing the vibrant red hue while adding extraordinary radiance and sophistication. This Teardrop Pendant effortlessly blends timeless elegance with modern charm, making it the perfect wedding necklace for brides seeking jewelry that feels both romantic and unforgettable. Romantic, radiant, and endlessly sophisticated, this Lab Grown Ruby Pendant is a celebration of love, elegance, and cherished moments. Designed to symbolize forever, this exquisite Ruby Bridal Necklace will remain a treasured keepsake filled with beauty, emotion, and timeless allure for years to come.

Product Information
SKU SHP-PENDANT062310075
Metal Weight 3.48 gm (Approximate)
Total Stone Weight 3.30 Carat (Approximate)
LAB CREATED RUBY INFORMATION
No.of Stones 1 Pieces
Total Weight 2.90 Carat (Approximate)
Dimension(approx) Pear-7X10 mm-1 Pcs
Color Red
Cut Brilliant
Shape Pear
Setting Type Prong-Setting
Quality Grade AAAA
DIAMOND INFORMATION
No.of Stones 62 Pieces
Total Weight 0.40 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-1 Pcs
Round-1.10X1.10 mm-2 Pcs
Round-1.40X1.40 mm-1 Pcs
Round-1.50X1.50 mm-1 Pcs
Round-1X1 mm-57 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
lab-created-ruby-necklace