12 Carat Freshwater Pearl and Diamond Infinity Drop Earrings

Sale price $1,205.00 Regular price $1,354.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Celebrate lasting connection with these Genuine Freshwater Pearl and Diamond Infinity Drop Earrings. Two luminous white pearl drops suspend beneath diamond-accented infinity motifs, bringing together soft pearl luster, flowing movement, and refined sparkle. With their symbolic infinity design and secure screw backs, these earrings make a meaningful choice for weddings, anniversaries, milestone gifts, and formal occasions.

12 Carat Freshwater Pearl Drop Earrings with Diamond Infinity Design

The pair features two drop-shaped freshwater pearls totaling approximately 12.00 carats, with each pearl measuring about 9 x 12 mm and graded AAA quality. Twenty round brilliant-cut diamonds totaling approximately 0.29 carat trace the infinity motifs in graduated sizes from about 0.80 mm to 1.60 mm. The HI color, SI quality diamonds are bead-set, while the earrings are crafted in 92.5 sterling silver with an approximate metal weight of 2.40 grams. The combined stone weight is approximately 12.29 carats.

What Makes These Pearl and Diamond Infinity Earrings Special

  • Two white freshwater pearl drops totaling approximately 12.00 carats.
  • Each pearl measures approximately 9 x 12 mm and is graded AAA quality.
  • Twenty round diamonds total approximately 0.29 carat.
  • Graduated diamond sizes create dimension along the infinity motifs.
  • HI color and SI quality brilliant-cut diamonds.
  • Bead-set pearl and diamond detailing.
  • Infinity-inspired drop design with secure screw-back closures.
  • Crafted in 92.5 sterling silver and selected yellow or white gold options in 10K, 14K, and 18K with an approximate metal weight of 2.40 grams.

Meaning Behind the Pearl and Diamond Infinity Drop Design

The infinity motif gives these pearl drop earrings a natural connection to enduring love, continuity, and lasting bonds. Suspended pearl drops add graceful movement beneath the diamond-set curves, while the combination of white pearls and bright diamonds keeps the design polished rather than overly ornate. This symbolism makes the pair especially fitting for bridal jewelry, anniversaries, romantic gifting, and significant relationship milestones.

Freshwater Pearl and Diamond Earring Authenticity & Craftsmanship

Rosec Jewels crafts these infinity drop earrings with attention to pearl alignment, secure bead settings, balanced movement, and refined finishing. Rosec Jewels offers a Certificate of Authenticity with the jewelry for added purchase confidence. Each piece also goes through stone inspection, setting security review, and finishing inspection before dispatch, with care guidance provided to help preserve the freshwater pearls, diamonds, and sterling silver finish.

Styling Freshwater Pearl Infinity Drop Earrings

The 9 x 12 mm pearl drops create visible movement below the ear, while the diamond infinity motifs add sparkle closer to the face. Their white pearl and sterling silver palette pairs naturally with bridal dresses, eveningwear, formal outfits, and other silver-toned jewelry. The screw-back closures also make them a secure choice for weddings, celebrations, anniversaries, and special-event wear.

Product Information
SKU SHP-EARRINGS082210227
Metal Weight 2.40 gm (Approximate)
Total Stone Weight 12.29 Carat (Approximate)
FRESHWATER PEARL INFORMATION
No.of Stones 2 Pieces
Total Weight 12.00 Carat (Approximate)
Dimension(approx) Drops-9X12 mm-2 Pcs
Color White
Cut Brilliant
Shape Drops
Setting Type Bead-Set
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 20 Pieces
Total Weight 0.29 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-4 Pcs
Round-0.90X0.90 mm-4 Pcs
Round-1.30X1.30 mm-4 Pcs
Round-1.50X1.50 mm-4 Pcs
Round-1.60X1.60 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade SI
View More

Product Parent Collection Handle
infinity-jewelry

FAQs About: Genuine Freshwater Pearl and Diamond Infinity Drop Earrings

What size are the freshwater pearls in these infinity drop earrings?

The earrings feature two drop-shaped white freshwater pearls measuring approximately 9 x 12 mm each. Together, the pearls weigh approximately 12.00 carats and are graded AAA quality.

How many diamonds are used in the infinity design?

The pair includes 20 round brilliant-cut diamonds totaling approximately 0.29 carat. The diamonds are arranged in graduated sizes along the infinity motifs and have HI color and SI quality.

What is the total stone weight of these pearl and diamond earrings?

The freshwater pearls total approximately 12.00 carats and the diamonds total approximately 0.29 carat, giving the earrings an approximate combined stone weight of 12.29 carats.

What does the infinity design symbolize?

The infinity motif is commonly associated with continuity and enduring connection. Combined with pearl drops and diamond accents, it gives the earrings meaningful relevance for anniversaries, weddings, romantic gifts, and milestone celebrations.

What metal and closure are used for these freshwater pearl drop earrings?

The earrings are crafted in 92.5 sterling silver and selected yellow or white gold options in 10K, 14K, and 18K with an approximate metal weight of 2.40 grams. They are finished with screw-back closures for secure wear.

Do these pearl and diamond earrings come with a Certificate of Authenticity?

Rosec Jewels offers a Certificate of Authenticity with the jewelry for added purchase confidence. Each piece also goes through stone inspection, setting security review, and finishing inspection before dispatch.

How should I care for freshwater pearl and diamond drop earrings?

Wipe the pearls gently with a soft, slightly damp cloth after wear and keep them away from perfumes, hairspray, harsh cleaners, and abrasive surfaces. Store the earrings separately when not worn and periodically check the diamond settings and screw backs for secure wear.