0.9 Carat Solitaire Tanzanite Heart Necklace with Diamond Bail

Regular price $854.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Capture hearts with this stunning Tanzanite Pendant Necklace, designed to convey profound feelings with a bold flair and timeless elegance. The Solitaire Pendant showcases a 6 MM heart shaped tanzanite held securely in 3-prong setting. Tanzanite is cherished for its striking look and symbolic power, making this piece a strong representation of love, new beginnings, and calmness. The design is further enhanced by a uniquely crafted bail studded with dainty diamonds that adds extra charm and highlights the heart motif. The meticulous detailing gives the Tanzanite Heart Necklace a unique appearance that feels both romantic and contemporary. Made from high-quality metal, this Heart Locket Necklace is built for durability and comfort, while still exuding a significant presence. Hanging from a matching chain (completely optional), the Tanzanite and Diamond Pendant gracefully rests along the neckline and complements both casual and formal attire effortlessly. This necklace is perfect for anniversaries, Valentine’s Day, proposals, birthdays, weddings, or as a thoughtful surprise for no particular reason. Whether you are celebrating love, friendship, or a special occasion, this piece narrates a story filled with emotion, purpose, and enduring beauty.

Product Information
SKU SHP-PENDANT032214751
Metal Weight 2.67 gm (Approximate)
Total Stone Weight 1.06 Carat (Approximate)
TANZANITE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.99 Carat (Approximate)
Dimension(approx) Heart-6X6 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Heart
Setting Type 3-Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 5 Pieces
Total Weight 0.06 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-5 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type 3-Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
tanzanite-necklaces