0.8 Carat Vintage Looking Tanzanite Diamond Wedding Bridal Ring Set of 2

Sale price $1,394.00 Regular price $1,566.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Inspired by the timeless charm of vintage elegance, this Wedding Bridal Ring Set is a true celebration of love and devotion. The Teardrop Engagement Ring dazzles with a 5X7mm Pear Shape Tanzanite, surrounded by a sparkling Diamond Halo and delicate side stones that catch the light from every angle. Its graceful teardrop shape evokes romance and sophistication, perfectly complemented by the Curved Wedding Band, which features a delicate Leaf motif, dainty Diamond stones and intricate Beaded detailing for an added touch of whimsy. This Vintage Wedding Ring Set tells a story of enduring love, where every curve and sparkle reflects the beauty of your shared journey. This Tanzanite Wedding Ring Set comes in a signature jewelry box, making it ready for a heartfelt proposal or an unforgettable gift. Available in multiple sizes, this pair is crafted for comfort as well as elegance, allowing her to wear it every day as a symbol of your commitment. Whether it is the soft glow of the AAA Quality Tanzanite or the gentle shimmer of HI-SI Quality Diamond stones along the band, this Wedding Engagement Ring Set captures the essence of romance, creating a keepsake she will treasure forever, a perfect harmony of classic style and heartfelt emotion.

Product Information
SKU SHP-RINGS032227627
Metal Weight 4.00 gm (Approximate)
Center Stone Weight 0.84 Carat (Approximate)
TANZANITE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.84 Carat (Approximate)
Dimension(approx) Pear-5X7 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Pear
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 45 Pieces
Total Weight 0.54 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-26 Pcs
Round-1X1 mm-18 Pcs
Round-2.40X2.40 mm-1 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
tanzanite-women-wedding-bands