0.4 Carat Bezel Set Amethyst Flower Engagement Ring with Diamond

Regular price $911.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Floral Expression of Elegance

This amethyst flower engagement ring is designed for those who appreciate nature-inspired beauty with a refined touch. The floral motif creates a soft and artistic silhouette, offering a distinctive alternative to traditional engagement ring styles.

Ideal for meaningful occasions, this ring suits individuals seeking a design that reflects both individuality and timeless charm.

Bezel Setting with Thoughtful Design

The bezel setting encircles the center stone with a smooth metal frame, providing a clean and modern finish. This design enhances durability by offering added protection to the gemstone, making it a practical choice for regular wear.

The floral arrangement is carefully crafted to balance visual appeal with structure, allowing the ring to feel both decorative and refined.

Amethyst and Diamond Harmony

Amethyst is valued for its rich purple hue and distinctive character, bringing depth and color to the design. Its presence creates a focal point that stands out while maintaining an elegant appearance.

Diamond accents introduce subtle brilliance, enhancing the overall composition and adding contrast to the vibrant center stone.

Designed for Versatile Wear

The balanced profile of this ring allows it to be worn comfortably as a standalone piece or paired with complementary bands. Its nature-inspired design adds a unique touch while remaining suitable for a variety of styles.

With its combination of artistic detailing and structured setting, this ring is designed to remain relevant across changing trends while offering lasting appeal.

Product Information
SKU SHP-RINGS032224088
Width 10 mm
Height 3.9 mm
Weight 2.24 gm (Approximate)
AMETHYST INFORMATION
No.of Stones 1 Pieces
Total Weight 0.45 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Voilet
Cut Brilliant
Shape Round
Setting Type Accent
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 12 Pieces
Total Weight 0.25 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-8 Pcs
Round-1.90X1.90 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Accent
Quality Grade SI
View More

Product Parent Collection Handle
amethyst-engagement-rings

FAQs About: 3/4 CT Bezel Set Amethyst Flower Engagement Ring with Diamond

Is a bezel set ring suitable for everyday wear?
Yes, bezel settings provide added protection to the stone, making them a practical option for regular wear when handled with care.
What makes the flower design unique?
The flower-inspired design reflects natural forms, offering a soft and artistic look that stands out from more traditional ring styles.
Is amethyst suitable for engagement rings?
Amethyst can be used in engagement rings and offers a distinctive look, though it benefits from careful handling during daily wear.
Can this ring be paired with a wedding band?
Yes, its structured design allows it to be paired with a variety of bands for a coordinated and balanced look.
Do amethyst and diamonds complement each other well?
Yes, the rich purple tone of amethyst pairs well with the brilliance of diamonds, creating a balanced and elegant contrast.
How should I care for this ring?
Clean it gently with mild soap and water, and store it separately to help maintain its finish and protect the gemstones.