Zircon Solitaire Infinity Engagement Ring with Side Stones

0
Regular price $3,229.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Zircon Solitaire Infinity Engagement Ring

This engagement ring features a zircon solitaire set at the center of an infinity inspired band. The design highlights the center gemstone while the flowing band structure introduces visual movement and symbolic detail. The solitaire arrangement allows the zircon to remain the primary focal point of the ring.

The combination of a central gemstone and side accents creates a balanced engagement ring that blends elegance with a meaningful design motif.

Infinity Inspired Ring Design

Infinity bands are known for their continuous looping form, a design element often associated with enduring connection and continuity. In engagement rings, this design adds visual interest while maintaining a refined and structured profile.

The flowing band complements the solitaire setting, guiding attention toward the center stone while creating a graceful silhouette around the finger.

Zircon Center Stone

Zircon is valued in jewelry for its natural brilliance and distinctive appearance. As a center gemstone, zircon provides a bright focal point that pairs well with complementary accent stones.

When used in a solitaire design, the gemstone remains visually prominent while allowing the surrounding structure of the ring to enhance its presentation.

Side Stone Accents

Side stones are incorporated along the band to add additional sparkle and highlight the central zircon. These accent stones create contrast between the band and the main gemstone while enhancing the overall brilliance of the ring.

The arrangement supports the center stone visually, creating a layered design that combines gemstone presence with refined decorative detail.

Product Information
SKU SHP-RINGS042014721
Width 5.6 mm
Height 6.8 mm
Weight 4.33 gm (Approximate)
ZIRCON INFORMATION
No.of Stones 21 Pieces
Total Weight 0.82 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-20 Pcs
Round-5X5 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAAA
View More

Product Parent Collection Handle
solitaire-engagement-rings

Frequently Asked Questions

What is an infinity engagement ring?
An infinity engagement ring features a band design shaped in continuous loops that symbolize continuity and connection.
What is zircon used for in jewelry?
Zircon is used as a gemstone in jewelry for its natural brilliance and distinctive appearance.
What is a solitaire engagement ring?
A solitaire engagement ring features a single center gemstone as the primary focal point of the design.
What role do side stones play in a ring?
Side stones highlight the center gemstone and add additional brilliance to the overall ring design.
Why choose a gemstone engagement ring?
Gemstone engagement rings provide distinctive color and visual character compared with traditional single gemstone designs.
What makes infinity band designs popular?
Infinity band designs are popular because their continuous shape creates a visually flowing structure that symbolizes lasting connection.