Zircon Sagittarius Zodiac Signet Unisex Ring

0
Regular price $3,030.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Personal Zodiac Signet Ring

The Zircon Sagittarius Zodiac Signet Unisex Ring is designed for those who want to wear their astrological identity with subtle confidence. Featuring the Sagittarius symbol engraved on a classic signet face and accented with zircon, this ring blends symbolism with refined craftsmanship. Its unisex structure makes it suitable for anyone who appreciates meaningful jewelry with a bold yet balanced presence.

Classic Signet with Contemporary Detail

Signet rings have long represented identity and personal heritage. In this design, the structured face showcases the Sagittarius motif, while the zircon adds a touch of light reflection that enhances the overall composition. The smooth contours and solid form create a ring that feels substantial while maintaining clean lines for everyday styling.

Zircon as a Distinctive Accent

Zircon is valued for its natural brilliance and clarity, offering a refined sparkle that complements the engraved zodiac detail. When worn with proper care, zircon can be enjoyed regularly as part of a signature look. Its subtle shine enhances the signet design without overwhelming its symbolic focus.

Designed for Everyday Expression

This unisex zodiac ring works as a personal keepsake, birthday gift, or meaningful accessory tied to one’s birth sign. Its versatile styling allows it to be worn alone as a statement piece or paired with other rings for a layered look. The overall design prioritizes symbolism, durability, and balanced proportions over fleeting trends.

Product Information
SKU SHP-RINGS042210298
Weight 4.00 gm (Approximate)
ZIRCON INFORMATION
No.of Stones 20 Pieces
Total Weight 0.16 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-2 Pcs
Round-0.90X0.90 mm-5 Pcs
Round-1.10X1.10 mm-2 Pcs
Round-1.20X1.20 mm-4 Pcs
Round-1.30X1.30 mm-1 Pcs
Round-1X1 mm-6 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Pave Setting
Quality Grade AAAA
View More

Product Parent Collection Handle
sagittarius-zodiac-sign-jewelry

FAQs About: Zircon Sagittarius Zodiac Signet Unisex Ring

Is this ring suitable for both men and women?
Yes. The balanced proportions and classic signet structure are designed to suit a wide range of personal styles, making it appropriate for unisex wear.
What does the Sagittarius symbol represent?
Sagittarius is associated with qualities such as optimism, independence, and exploration. Wearing the symbol allows the ring to reflect personal identity and astrological meaning.
Is zircon durable enough for regular wear?
Zircon is suitable for regular wear when handled with care. Removing the ring during heavy impact activities can help preserve the gemstone’s appearance over time.
Can this zodiac ring be given as a birthday gift?
Yes. Zodiac jewelry is a thoughtful birthday gift, especially for someone who identifies strongly with their Sagittarius sign.
How should I care for this signet ring?
Clean gently with mild soap, lukewarm water, and a soft cloth. Avoid harsh chemicals and store separately to help maintain the metal finish and gemstone clarity.