Virgo Zodiac Sign Disc Pendant with Pave Set Moissanite

Regular price $3,447.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Personal Pendant with Zodiac Meaning

The Virgo Zodiac Sign Disc Pendant with Pave Set Moissanite is designed for those who value personal symbolism expressed through refined jewelry. The disc format creates a clean and balanced surface, allowing the Virgo motif to stand out clearly.

It offers a subtle yet meaningful way to represent identity, making it suitable for everyday wear or thoughtful gifting.

Disc Design with Pave Detailing

The circular disc design provides a structured and modern foundation, ensuring the pendant sits smoothly when worn. The engraved or detailed zodiac symbol is framed within the surface, maintaining visual clarity.

Pave set stones are arranged closely together, adding fine texture and a continuous sparkle without overwhelming the design.

Moissanite Accents with Refined Brilliance

Moissanite is valued for its brightness and durability, making it suitable for regular wear. It offers consistent sparkle while maintaining a refined appearance.

The pave setting enhances light reflection across the surface, adding dimension while keeping the overall look balanced and wearable.

High-Level Features Buyers Appreciate

The pendant is designed to rest comfortably against the neckline, making it easy to wear throughout the day. Its clean form allows it to be styled alone or layered with other necklaces.

The combination of symbolic design, structured form, and subtle brilliance makes it a versatile addition to any jewelry collection.

Product Information
SKU SHP-PENDANT042210276
Weight 4.56 gm (Approximate)
Center Stone Weight 1.16 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 80 Pieces
Total Weight 1.16 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-1 Pcs
Round-1.10X1.10 mm-1 Pcs
Round-1.20X1.20 mm-74 Pcs
Round-1.40X1.40 mm-2 Pcs
Round-1X1 mm-2 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
virgo-zodiac-sign-jewelry

FAQs About: Virgo Zodiac Sign Disc Pendant with Pave Set Moissanite

What does the Virgo zodiac symbol represent?
The Virgo symbol is often associated with traits like practicality, attention to detail, and thoughtful nature.
Is moissanite suitable for everyday wear?
Yes, moissanite is durable and suitable for regular wear with proper care.
What is a pave setting?
A pave setting involves placing small stones closely together to create a continuous surface of sparkle.
Can this pendant be layered with other necklaces?
Yes, its simple disc design makes it ideal for layering with other pieces.
Is this pendant suitable for gifting?
Yes, its zodiac theme makes it a meaningful gift for birthdays or special occasions.
Who is this pendant ideal for?
It is ideal for individuals who want a personalized piece with subtle sparkle and symbolic meaning.