Vintage Lab Created Ruby Bridal Drop Earrings with Diamonds

Regular price $2,929.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Elegance from another era meets modern sophistication in these Vintage Wedding Earrings, created for the bride who loves timeless beauty with a personal touch. The design features a 4X5 MM oval cut lab created ruby set securely in claw setting. The ruby’s rich color symbolizes love, passion, and strength, making it a perfect choice for weddings and meaningful celebrations. Surrounding the center stone is a dazzling halo of round cut diamonds, carefully arranged to catch and reflect the light beautifully. The intricate petal-like halo design gives these Ruby and Diamond Earrings their signature vintage charm, blending the elegance of classic jewelry with the freshness of modern craftsmanship. Each petal is detailed with tiny beaded accents and sparkling lab diamonds, adding texture and depth to the design while enhancing its antique-inspired feel. A smaller diamond-studded round motif sits gracefully at the top, connecting to the drop and completing the look with refined balance. The screw back closure ensures comfort and a secure fit, letting you wear these Vintage Ruby Earrings with confidence all day and night. Perfect for weddings, anniversaries, or grand occasions, these Ruby Drop Earrings bring an air of romance and sophistication to any look.

Product Information
SKU SHP-EARRINGS112114698
Length 17.2 mm
Width 4 mm
Height 1.5 mm
Metal Weight 2.90 gm (Approximate)
Total Stone Weight 1.46 Carat (Approximate)
LAB CREATED RUBY INFORMATION
No.of Stones 2 Pieces
Total Weight 0.84 Carat (Approximate)
Dimension(approx) Oval-4X5 mm-2 Pcs
Color Red
Cut Brilliant
Shape Oval
Setting Type Claw-Set
Quality Grade AAAA
DIAMOND INFORMATION
No.of Stones 100 Pieces
Total Weight 0.62 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-22 Pcs
Round-0.90X0.90 mm-42 Pcs
Round-1.10X1.10 mm-14 Pcs
Round-1.30X1.30 mm-22 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade SI
View More

Product Parent Collection Handle
lab-created-ruby-earrings