Solitaire Pink Tourmaline Infinity Promise Ring with Diamond

Sale price $1,946.00 Regular price $2,187.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Made for a promise that feels deeply personal, this Pink Tourmaline Infinity Promise Ring brings together soft color, meaningful symbolism, and a graceful diamond-accented silhouette. At the center rests a round pink tourmaline in a brilliant cut, held in a claw setting so its romantic pink tone can remain the focus. The infinity-inspired design wraps the center stone with a sense of continuous devotion, while round brilliant diamonds add delicate sparkle along the motif.

Thoughtful without feeling overstated, this ring is a meaningful choice for a promise, proposal, anniversary, birthday, or any milestone that deserves a symbol of lasting affection.

Solitaire Pink Tourmaline Infinity Promise Ring with Diamond Accents

This solitaire promise ring is designed with one round pink tourmaline of approximately 0.45 carat, measuring about 5 x 5 mm, complemented by 20 round brilliant diamonds totaling approximately 0.15 carat. The center gemstone is claw-set for a lifted, light-catching look, while the diamond accents bring refined brilliance to the infinity design. The ring has a width of approximately 5 mm, a height of approximately 3.6 mm, and an approximate weight of 1.84 gm in the selected configuration.

What Makes This Special

  • One round brilliant cut pink tourmaline sits at the center as the main solitaire gemstone.
  • The center stone is approximately 0.45 carat and measures about 5 x 5 mm.
  • Twenty round brilliant cut diamonds add approximately 0.15 carat of accent sparkle.
  • The pink tourmaline is claw-set, allowing its color and round shape to stand out clearly.
  • The diamonds are also claw-set, creating a fine shimmer across the infinity-inspired design.
  • AAA quality grade is specified for the pink tourmaline, while the diamonds are listed with HI color and SI quality grade.
  • Available metal choices include 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold.

Why Choose This Design

The round brilliant cut gives the pink tourmaline a lively presence, making the center stone feel bright, romantic, and easy to notice without overwhelming the hand. The claw setting keeps the gemstone visually open, helping light reach the stone from multiple angles. Around it, the diamond accents create a soft frame of sparkle, adding contrast to the pink center while keeping the overall design graceful and wearable.

The infinity detail gives this promise ring more meaning than a simple solitaire. It carries the feeling of continuity, loyalty, and a bond that grows stronger with time, making it especially fitting for commitments, relationship milestones, and heartfelt gifting.

Design Meaning

The infinity motif represents love without a defined end, making this ring a fitting symbol for a promise, a new chapter, or a commitment shared between two people. Pink tourmaline brings a soft, affectionate color to the design, giving the ring a warm and expressive personality. Paired with diamond accents, the look feels sentimental yet polished, ideal for someone who values jewelry with emotional depth as much as visual sparkle.

Authenticity & Craftsmanship

Rosec Jewels crafts this ring with attention to stone placement, setting security, and refined finishing so it feels as thoughtful as the promise it represents. Each piece goes through stone inspection, setting security review, and finishing inspection before dispatch. A Certificate of Authenticity is offered with the ring for added purchase confidence, and care guidance is provided to help preserve the ring’s sparkle, setting, and finish over time.

Style and Wearability

This pink tourmaline promise ring has a graceful profile that works for both meaningful occasions and personal everyday styling. The round center stone gives it a romantic focal point, while the diamond-accented infinity design adds detail from the sides without making the ring feel heavy. It pairs naturally with delicate bands, simple diamond jewelry, or gemstone pieces in similar soft tones. With multiple metal options available, the design can be chosen in a finish that best suits the wearer’s personal style.

Product Information
SKU SHP-RINGS032223964
Width 5 mm
Height 3.6 mm
Weight 1.84 gm (Approximate)
PINK TOURMALINE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.45 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Pink
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 20 Pieces
Total Weight 0.15 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-6 Pcs
Round-1.10X1.10 mm-10 Pcs
Round-1X1 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade SI
View More

Product Parent Collection Handle
tourmaline-engagement-rings

FAQs About: Solitaire Pink Tourmaline Infinity Promise Ring with Diamond

What makes this pink tourmaline ring suitable for a promise or proposal?

The ring combines a romantic pink tourmaline center stone with an infinity-inspired design, making it a meaningful symbol of lasting commitment. Its diamond accents add a refined touch of sparkle, which makes it suitable for a promise, proposal, anniversary, or sentimental gift.

What does the infinity design symbolize in this ring?

The infinity design represents continuous love, loyalty, and an enduring bond. In this ring, the motif supports the solitaire pink tourmaline and adds emotional meaning to the piece without taking attention away from the center gemstone.

What gemstone is used as the center stone?

The center stone is one round brilliant cut pink tourmaline with an approximate total weight of 0.45 carat. It measures about 5 x 5 mm and is secured in a claw setting.

Does this ring include diamond accents?

Yes. The ring includes 20 round brilliant cut diamonds with an approximate total weight of 0.15 carat. The diamonds are claw-set and are listed with HI color and SI quality grade.

Which metal options are available for this promise ring?

This ring is available in 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold.

Does this ring come with authenticity assurance?

Rosec Jewels offers a Certificate of Authenticity with the jewelry. Each ring also goes through stone inspection, setting security review, and finishing inspection before dispatch.

How should I care for this pink tourmaline and diamond ring?

Store the ring separately in a soft jewelry pouch or box, and avoid harsh chemicals, impact, and abrasive surfaces. Clean it gently with a soft cloth, and follow the care guidance provided with the product to help protect the gemstones, settings, and metal finish.